close

SimulationCraft 703-04

for World of Warcraft 7.0.3 Live (wow build level 22522, git build 3b21ce5)

Current simulator hotfixes

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Kwetrose

Kwetrose : 22067 dps, 92577 dtps, 0 hps (0 aps), 81.0k TMI, 80.5k ETMI

  • Race: Gnome
  • Class: Deathknight
  • Spec: Blood
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
22067.1 22067.1 23.0 / 0.104% 4466.7 / 20.2% -1.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
92577.4 41.73 / 0.05% 8406 / 9.1%       81.0k 10 / 0.01% 78.6k 82.8k 2.0k / 2.5%       35.5% 30.5% 38.1% 9.8       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Runic Power 99.65% 1.3 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Kwetrose/advanced
Talents
  • 15: Heartbreaker (Blood Death Knight)
  • 30: Rapid Decomposition (Blood Death Knight)
  • 45: Ossuary (Blood Death Knight)
  • 60: Red Thirst (Blood Death Knight)
  • 75: Tightening Grasp (Blood Death Knight)
  • 90: Foul Bulwark (Blood Death Knight)
  • 100: Purgatory (Blood Death Knight)
  • Talent Calculator
Artifact
Professions
  • alchemy: 750
  • herbalism: 798

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Kwetrose 22067
auto_attack_mh 14473 65.9% 148.5 3.06sec 43904 14453 Direct 148.5 36532 73078 43904 20.2% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.45 148.45 0.00 0.00 3.0377 0.0000 6517755.31 9801430.70 33.50 14453.16 14453.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.66 73.87% 37369.14 34956 38912 37369.70 36380 38410 4097749 6024080 31.98
hit (blocked) 8.85 5.96% 26169.07 24469 27239 26170.72 24469 27239 231664 486526 52.38
crit 27.71 18.66% 74752.33 69911 77825 74752.29 70990 77385 2071277 3044974 31.98
crit (blocked) 2.24 1.51% 52335.76 48938 54477 46559.15 0 54477 117064 245851 46.61
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 6140 27.5% 17.3 5.15sec 157122 0 Direct 17.3 130761 261389 157122 20.2% 7.4%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.32 17.32 0.00 0.00 0.0000 0.0000 2721728.16 4092820.68 33.50 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.80 73.91% 133732.42 133732 133732 133732.42 133732 133732 1712147 2517018 31.98
hit (blocked) 1.02 5.91% 93612.69 93613 93613 60844.97 0 93613 95860 201318 34.05
crit 3.23 18.65% 267464.83 267465 267465 259921.57 0 267465 864158 1270395 31.08
crit (blocked) 0.26 1.53% 187225.38 187225 187225 43534.25 0 187225 49564 104090 12.18
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Spear of Light 1455 6.6% 8.0 60.00sec 81469 0 Direct 8.0 67832 135664 81472 20.1% 0.0%  

Stats details: spear_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.03 8.03 0.00 0.00 0.0000 0.0000 654277.66 654277.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 79.90% 67831.97 67832 67832 67831.97 67832 67832 435240 435240 0.00
crit 1.61 20.10% 135663.94 135664 135664 112924.39 0 135664 219038 219038 0.00
 
 

Action details: spear_of_light

Static Values
  • id:214203
  • school:holy
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214203
  • name:Spear of Light
  • school:holy
  • tooltip:Stunned.
  • description:Pierce your target with a spear of light, dealing {$s1=50970} Holy damage and stunning them for {$d=5 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:58620.00
  • base_dd_max:58620.00
 
Simple Action Stats Execute Interval
Kwetrose
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 27.9 16.14sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 27.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.75% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 58.0sec 0.0sec 10.83% 10.86% 0.0(0.0) 2.0

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Unholy Strength 12.8 15.1 35.8sec 16.1sec 65.93% 63.62% 15.1(15.1) 12.2

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:65.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Kwetrose
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Kwetrose
Resource RPS-Gain RPS-Loss
Health 12829.31 92578.30
Combat End Resource Mean Min Max
Runic Power 0.00 0.00 0.00
Rune 6.00 6.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 31.9 13.7sec

Statistics & Data Analysis

Fight Length
Sample Data Kwetrose Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Kwetrose Damage Per Second
Count 9999
Mean 22067.15
Minimum 18748.35
Maximum 26938.75
Spread ( max - min ) 8190.41
Range [ ( max - min ) / 2 * 100% ] 18.56%
Standard Deviation 1173.6936
5th Percentile 20316.88
95th Percentile 24131.89
( 95th Percentile - 5th Percentile ) 3815.01
Mean Distribution
Standard Deviation 11.7375
95.00% Confidence Intervall ( 22044.14 - 22090.15 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10867
0.1 Scale Factor Error with Delta=300 11759
0.05 Scale Factor Error with Delta=300 47038
0.01 Scale Factor Error with Delta=300 1175961
Priority Target DPS
Sample Data Kwetrose Priority Target Damage Per Second
Count 9999
Mean 22067.15
Minimum 18748.35
Maximum 26938.75
Spread ( max - min ) 8190.41
Range [ ( max - min ) / 2 * 100% ] 18.56%
Standard Deviation 1173.6936
5th Percentile 20316.88
95th Percentile 24131.89
( 95th Percentile - 5th Percentile ) 3815.01
Mean Distribution
Standard Deviation 11.7375
95.00% Confidence Intervall ( 22044.14 - 22090.15 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10867
0.1 Scale Factor Error with Delta=300 11759
0.05 Scale Factor Error with Delta=300 47038
0.01 Scale Factor Error with Delta=300 1175961
DPS(e)
Sample Data Kwetrose Damage Per Second (Effective)
Count 9999
Mean 22067.15
Minimum 18748.35
Maximum 26938.75
Spread ( max - min ) 8190.41
Range [ ( max - min ) / 2 * 100% ] 18.56%
Damage
Sample Data Kwetrose Damage
Count 9999
Mean 9893761.13
Minimum 7508956.17
Maximum 12540815.50
Spread ( max - min ) 5031859.34
Range [ ( max - min ) / 2 * 100% ] 25.43%
DTPS
Sample Data Kwetrose Damage Taken Per Second
Count 9999
Mean 92577.41
Minimum 84030.12
Maximum 102320.57
Spread ( max - min ) 18290.45
Range [ ( max - min ) / 2 * 100% ] 9.88%
Standard Deviation 2129.0218
5th Percentile 89011.96
95th Percentile 96015.51
( 95th Percentile - 5th Percentile ) 7003.54
Mean Distribution
Standard Deviation 21.2913
95.00% Confidence Intervall ( 92535.68 - 92619.14 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2031
0.1 Scale Factor Error with Delta=300 38694
0.05 Scale Factor Error with Delta=300 154776
0.01 Scale Factor Error with Delta=300 3869402
HPS
Sample Data Kwetrose Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Kwetrose Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kwetrose Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kwetrose Healing Taken Per Second
Count 9999
Mean 12829.45
Minimum 8268.84
Maximum 19100.90
Spread ( max - min ) 10832.06
Range [ ( max - min ) / 2 * 100% ] 42.22%
TMI
Sample Data Kwetrose Theck-Meloree Index
Count 9999
Mean 81011.84
Minimum 78605.74
Maximum 82844.10
Spread ( max - min ) 4238.36
Range [ ( max - min ) / 2 * 100% ] 2.62%
Standard Deviation 518.1799
5th Percentile 80132.33
95th Percentile 81840.22
( 95th Percentile - 5th Percentile ) 1707.89
Mean Distribution
Standard Deviation 5.1821
95.00% Confidence Intervall ( 81001.68 - 81022.00 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 157
0.1 Scale Factor Error with Delta=300 2292
0.05 Scale Factor Error with Delta=300 9168
0.01 Scale Factor Error with Delta=300 229215
ETMI
Sample Data KwetroseTheck-Meloree Index (Effective)
Count 9999
Mean 80521.98
Minimum 78158.41
Maximum 82406.44
Spread ( max - min ) 4248.03
Range [ ( max - min ) / 2 * 100% ] 2.64%
Standard Deviation 525.3747
5th Percentile 79641.74
95th Percentile 81372.50
( 95th Percentile - 5th Percentile ) 1730.76
Mean Distribution
Standard Deviation 5.2540
95.00% Confidence Intervall ( 80511.68 - 80532.28 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 163
0.1 Scale Factor Error with Delta=300 2356
0.05 Scale Factor Error with Delta=300 9425
0.01 Scale Factor Error with Delta=300 235625
MSD
Sample Data Kwetrose Max Spike Value
Count 1257
Mean 35.46
Minimum 30.46
Maximum 38.11
Spread ( max - min ) 7.65
Range [ ( max - min ) / 2 * 100% ] 10.79%
Standard Deviation 1.6534
5th Percentile 31.77
95th Percentile 37.23
( 95th Percentile - 5th Percentile ) 5.45
Mean Distribution
Standard Deviation 0.0466
95.00% Confidence Intervall ( 35.37 - 35.55 )
Normalized 95.00% Confidence Intervall ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8352
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 2

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking,if=buff.pillar_of_frost.up
6 8.03 use_item,slot=trinket2
7 1.00 potion,name=old_war
0.00 sindragosas_fury,if=buff.pillar_of_frost.up
8 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
9 0.00 call_action_list,name=shatter,if=talent.shattering_strikes.enabled
A 0.00 call_action_list,name=icytalons,if=talent.icy_talons.enabled
B 0.00 call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)

Sample Sequence

01245676666666

Sample Sequence Table

time name target resources buffs
Pre flask Kwetrose 0.0/121: 0% runic_power | 6.0/6: 100% rune
Pre food Kwetrose 0.0/121: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Kwetrose 0.0/121: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength, potion_of_the_old_war
0:00.000 Waiting 57.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength, potion_of_the_old_war
0:57.800 potion Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune
0:58.000 Waiting 1.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
1:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
1:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
2:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
2:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune
3:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune
3:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
4:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
4:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
5:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
5:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune
6:00.000 Waiting 59.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune
6:59.800 use_item_gift_of_radiance Fluffy_Pillow 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength
7:00.000 Waiting 32.800 sec 0.0/121: 0% runic_power | 6.0/6: 100% rune unholy_strength

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 24357 22732 12505 (9698)
Agility 7859 7534 0
Stamina 46448 46448 19056
Intellect 4330 4005 0
Spirit 0 0 0
Health 2786880 2786880 0
Runic Power 121 121 0
Rune 6 6 0
Crit 20.24% 19.17% 4958
Haste 7.20% 7.20% 1995
Damage / Heal Versatility 4.25% 4.25% 1699
Mitigation Versatility 2.12% 2.12% 1699
Attack Power 32587 30413 0
Mastery 50.69% 50.69% 9026
Armor 4618 4618 4016
Run Speed 7 0 0
Leech 1.34% 1.34% 308
Avoidance 0 0 404
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 21.00% 19.76% 4958
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 846.00
Local Head Crown of Steely Brambles
ilevel: 850, stats: { 555 Armor, +1945 Sta, +1297 StrInt, +848 Crit, +456 Mastery }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }
Local Shoulders Dread-Stricken Shoulderguards
ilevel: 840, stats: { 501 Armor, +886 StrInt, +1329 Sta, +633 Crit, +310 Mastery, +404 Avoidance }
Local Chest Horror Inscribed Chestguard
ilevel: 850, stats: { 683 Armor, +1945 Sta, +1297 StrInt, +932 Crit, +372 Haste }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Greaves of Ruinous Dominion
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +763 Vers, +494 Mastery }
Local Feet Nightsfall Sabatons
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +584 Haste, +378 Mastery }
Local Wrists Skoldiir Bracers
ilevel: 840, stats: { 292 Armor, +665 StrInt, +997 Sta, +429 Crit, +278 Mastery }
Local Hands Blood-Spattered Gauntlets
ilevel: 850, stats: { 427 Armor, +1459 Sta, +973 StrInt, +637 Mastery, +342 Vers }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Haste, +308 Leech }
Local Finger2 Val'kyr Ascension Signet
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Mastery }
Local Trinket1 Nightmare Bark
ilevel: 840, stats: { +1123 Str, +898 Mastery }
Local Trinket2 Gift of Radiance
ilevel: 825, stats: { +831 StrAgi, +722 Mastery }
Local Back Drape of Vile Misfortune
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Mastery, +278 Crit }
Local Main Hand Maw of the Damned
ilevel: 878, weapon: { 8712 - 13070, 3.6 }, stats: { +1684 Str, +2526 Sta, +737 Crit, +707 Mastery }, enchant: rune_of_the_fallen_crusader, relics: { +46 ilevels, +42 ilevels, +40 ilevels }
Local Tabard Gilneas Tabard
ilevel: 1

Talents

Level
15 Bloodworms (Blood Death Knight) Heartbreaker (Blood Death Knight) Blooddrinker (Blood Death Knight)
30 Rapid Decomposition (Blood Death Knight) Soulgorge (Blood Death Knight) Spectral Deflection (Blood Death Knight)
45 Ossuary (Blood Death Knight) Blood Tap (Blood Death Knight) Anti-Magic Barrier (Blood Death Knight)
60 Mark of Blood (Blood Death Knight) Red Thirst (Blood Death Knight) Tombstone (Blood Death Knight)
75 Tightening Grasp (Blood Death Knight) Tremble Before Me (Blood Death Knight) March of the Damned (Blood Death Knight)
90 Will of the Necropolis (Blood Death Knight) Rune Tap (Blood Death Knight) Foul Bulwark (Blood Death Knight)
100 Bonestorm (Blood Death Knight) Blood Mirror (Blood Death Knight) Purgatory (Blood Death Knight)

Profile

deathknight="Kwetrose"
origin="https://eu.api.battle.net/wow/character/hyjal/Kwetrose/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/151/145487255-avatar.jpg"
level=110
race=gnome
role=tank
position=front
professions=alchemy=750/herbalism=798
talents=http://eu.battle.net/wow/en/tool/talent-calculator#da!1001022
artifact=15:0:0:0:0:272:2:274:3:277:3:278:1:280:3:281:1:282:1:284:1:289:1:1331:1
spec=blood

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/use_item,slot=trinket2
actions+=/potion,name=old_war
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=shatter,if=talent.shattering_strikes.enabled
actions+=/call_action_list,name=icytalons,if=talent.icy_talons.enabled
actions+=/call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)

actions.bos=call_action_list,name=core
actions.bos+=/empower_rune_weapon,if=runic_power<=70


actions.generic=call_action_list,name=core
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.icytalons=call_action_list,name=core
actions.icytalons+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.shatter=call_action_list,name=core
actions.shatter+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled

head=crown_of_steely_brambles,id=139231,bonus_id=1807/1472
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336
shoulders=dreadstricken_shoulderguards,id=134521,bonus_id=1727/40/1492/1813
back=drape_of_vile_misfortune,id=137530,bonus_id=1727/1492/1813
chest=horror_inscribed_chestguard,id=138216,bonus_id=1807/1472
tabard=gilneas_tabard,id=64882
wrists=skoldiir_bracers,id=134186,bonus_id=1727/1502/1813
hands=bloodspattered_gauntlets,id=137525,bonus_id=1727/1502/3336
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=greaves_of_ruinous_dominion,id=134515,bonus_id=1727/1492/1813
feet=nightsfall_sabatons,id=139061,bonus_id=3432/1507/3336
finger1=archdruids_tainted_seal,id=134487,bonus_id=1727/1808/41/1497/3336
finger2=valkyr_ascension_signet,id=133679,bonus_id=1727/1808/1502/3336
trinket1=nightmare_bark,id=121287,bonus_id=3397/605/1502/3336
trinket2=gift_of_radiance,id=133647,bonus_id=1726/1477
main_hand=maw_of_the_damned,id=128402,bonus_id=716,gem_id=141523/133684/141268/0,relic_id=1472/1727:1497:3336/3432:1502:3336/0,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=846.20
# gear_strength=12505
# gear_stamina=19056
# gear_crit_rating=4958
# gear_haste_rating=1995
# gear_mastery_rating=9026
# gear_versatility_rating=1699
# gear_leech_rating=308
# gear_avoidance_rating=404
# gear_armor=4016

Decalang

Decalang : 176751 dps

  • Race: Draenei
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
176751.1 176751.1 101.2 / 0.057% 20318.2 / 11.5% 38612.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.6 4.6 Runic Power 29.56% 35.7 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced
Talents
  • 15: Shattering Strikes (Frost Death Knight)
  • 30: Freezing Fog (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: White Walker (Frost Death Knight)
  • 90: Frostscythe (Frost Death Knight)
  • 100: Glacial Advance (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 769
  • jewelcrafting: 760

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Decalang 176751
auto_attack_mh 10174 5.8% 227.9 1.99sec 20104 10172 Direct 227.9 19213 38428 20104 23.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 227.89 227.89 0.00 0.00 1.9763 0.0000 4581473.09 6735199.41 31.98 10172.44 10172.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.59 57.30% 19212.63 16795 21625 19214.01 18495 19758 2508926 3688359 31.98
crit 53.93 23.67% 38427.53 33590 43250 38430.95 36407 40326 2072547 3046841 31.98
miss 43.37 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5101 2.9% 227.9 1.99sec 10081 5101 Direct 227.9 9634 19265 10081 23.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 227.89 227.89 0.00 0.00 1.9763 0.0000 2297259.87 3377189.61 31.98 5100.70 5100.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.69 57.35% 9633.76 8397 10812 9634.40 9362 9937 1259014 1850870 31.98
crit 53.89 23.65% 19264.59 16795 21625 19266.05 18340 20312 1038246 1526319 31.98
miss 43.31 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Crystalline Swords 10452 5.9% 66.3 13.56sec 70999 0 Direct 66.3 57455 114918 70999 23.6% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.28 66.28 0.00 0.00 0.0000 0.0000 4705776.42 4705776.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.66 76.43% 57455.46 43293 72292 57462.91 53168 62188 2910551 2910551 0.00
crit 15.62 23.57% 114918.02 86587 144584 114930.27 97398 136907 1795225 1795225 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 13122 7.4% 29.1 15.91sec 203254 0 Periodic 149.1 32058 64110 39640 23.7% 0.0% 98.1%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 0.00 149.14 149.14 0.0000 2.9639 5911746.79 5911746.79 0.00 13374.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.9 76.34% 32057.90 8 41417 32062.01 30315 33755 3650030 3650030 0.00
crit 35.3 23.66% 64109.98 19 82835 64118.78 56034 71431 2261717 2261717 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frost Strike 0 (48440) 0.0% (27.4%) 82.4 5.44sec 264718 206579

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.37 0.00 0.00 0.00 1.2814 0.0000 0.00 0.00 0.00 206579.15 206579.15
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.obliteration.up&!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 32292 18.3% 82.4 5.44sec 176467 0 Direct 82.4 142775 285443 176466 23.6% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.37 82.37 0.00 0.00 0.0000 0.0000 14535993.50 14535993.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.92 76.38% 142775.48 93389 202793 142799.85 130250 155368 8983474 8983474 0.00
crit 19.45 23.62% 285442.57 186779 405586 285460.08 216945 357606 5552519 5552519 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 16148 9.1% 82.4 5.44sec 88251 0 Direct 82.4 71399 142671 88251 23.6% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.37 82.37 0.00 0.00 0.0000 0.0000 7269468.44 7269468.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.90 76.36% 71399.14 46697 101400 71416.15 64884 77657 4490718 4490718 0.00
crit 19.48 23.64% 142670.90 93393 202800 142688.48 114739 172045 2778751 2778751 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frostscythe 22723 12.9% 33.2 13.56sec 307929 239576 Direct 33.2 0 307929 307929 100.0% 0.0%  

Stats details: frostscythe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.22 33.22 0.00 0.00 1.2853 0.0000 10229415.77 10229415.77 0.00 239575.99 239575.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 33.22 100.00% 307928.65 244936 379914 307958.61 284549 332081 10229416 10229416 0.00
 
 

Action details: frostscythe

Static Values
  • id:207230
  • school:frost
  • resource:rune
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
Spelldata
  • id:207230
  • name:Frostscythe
  • school:frost
  • tooltip:
  • description:A sweeping attack that strikes all enemies in front of you for $sw1 Frost damage. This attack benefits from Killing Machine. Critical strikes with Frostscythe deal {$s3=4} times normal damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.35
 
Glacial Advance 0 (15339) 0.0% (8.7%) 31.5 14.51sec 219525 171102

Stats details: glacial_advance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.46 0.00 0.00 0.00 1.2830 0.0000 0.00 0.00 0.00 171102.42 171102.42
 
 

Action details: glacial_advance

Static Values
  • id:194913
  • school:frost
  • resource:rune
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194913
  • name:Glacial Advance
  • school:shadow
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, each dealing {$195975s1=0} Frost damage to enemies near their eruption point.
 
    Glacial Advance (_damage) 15339 8.7% 31.5 14.51sec 219525 0 Direct 31.5 177666 354597 219529 23.7% 0.0%  

Stats details: glacial_advance_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.46 31.46 0.00 0.00 0.0000 0.0000 6905522.68 6905522.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.01 76.34% 177666.09 135292 225913 177700.26 160128 193942 4266624 4266624 0.00
crit 7.44 23.66% 354596.98 270584 451826 354404.64 0 443611 2638899 2638899 0.00
 
 

Action details: glacial_advance_damage

Static Values
  • id:195975
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195975
  • name:Glacial Advance
  • school:frost
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, damaging enemies near their eruption point for {$s1=0} frost damage.
 
Howling Blast 11535 6.5% 29.1 15.91sec 178435 139053 Direct 29.1 144250 288843 178426 23.6% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 29.09 0.00 0.00 1.2832 0.0000 5189871.38 5189871.38 0.00 139052.90 139052.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.21 76.36% 144250.31 32245 215370 143636.89 80007 181000 3203702 3203702 0.00
crit 6.88 23.64% 288843.40 64489 430741 286935.03 0 422909 1986169 1986169 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Infested Ground 3072 1.7% 8.0 60.25sec 172889 0 Direct 78.8 14172 28344 17533 23.7% 0.0%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.99 78.83 0.00 0.00 0.0000 0.0000 1382157.99 1382157.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.13 76.28% 14172.09 14172 14172 14172.09 14172 14172 852228 852228 0.00
crit 18.70 23.72% 28344.18 28344 28344 28344.18 28344 28344 529930 529930 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Obliterate 0 (17161) 0.0% (9.7%) 52.4 8.59sec 147384 115803

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.38 0.00 0.00 0.00 1.2727 0.0000 0.00 0.00 0.00 115802.59 115802.59
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 11434 6.5% 52.4 8.59sec 98190 0 Direct 52.4 69068 171264 98190 28.5% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.38 52.38 0.00 0.00 0.0000 0.0000 5143667.13 7561677.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.46 71.50% 69068.14 60108 77050 69079.58 66251 72894 2587098 3803279 31.98
crit 14.93 28.50% 171263.88 149067 191084 171276.16 153806 186460 2556569 3758399 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
    Obliterate Off-Hand 5727 3.2% 52.4 8.59sec 49194 0 Direct 52.4 34531 85659 49194 28.7% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.38 52.38 0.00 0.00 0.0000 0.0000 2577007.41 3788445.00 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.36 71.32% 34531.49 30055 38526 34538.17 32912 36297 1290170 1896672 31.98
crit 15.02 28.68% 85659.45 74537 95545 85671.64 74537 93956 1286837 1891773 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
Potion of the Old War 7782 4.3% 23.4 3.75sec 147164 0 Direct 23.4 118963 237926 147162 23.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 0.0000 0.0000 3448897.63 5070206.21 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.88 76.29% 118962.79 118963 118963 118962.79 118963 118963 2127065 3126987 31.98
crit 5.56 23.71% 237925.57 237926 237926 237402.08 0 237926 1321833 1943219 31.91
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice (_oh) 5413 3.1% 319.3 1.41sec 7632 0 Direct 319.3 6172 12344 7632 23.7% 0.0%  

Stats details: razorice_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 319.32 319.32 0.00 0.00 0.0000 0.0000 2437161.50 2437161.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 243.75 76.34% 6171.66 5135 7273 6172.57 5973 6431 1504346 1504346 0.00
crit 75.57 23.66% 12344.42 10270 14546 12346.32 11629 13421 932815 932815 0.00
 
 

Action details: razorice_oh

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 6436 3.6% 17.4 26.20sec 167063 129691 Periodic 137.5 17064 34113 21090 23.6% 0.0% 30.5%

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.35 0.00 137.47 137.47 1.2882 1.0000 2899363.48 2899363.48 0.00 18140.18 129690.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.0 76.39% 17064.16 12988 21688 17066.06 15278 18808 1791918 1791918 0.00
crit 32.5 23.61% 34113.31 25976 43375 34119.91 30292 39492 1107445 1107445 0.00
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.frozen_soul.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
Simple Action Stats Execute Interval
Decalang
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.9 181.78sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<=70
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:false
  • if_expr:
 
Pillar of Frost 9.5 50.72sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 29.9 15.13sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.92 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Decalang
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.87% 0.0(0.0) 1.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Killing Machine 36.8 2.6 12.3sec 11.5sec 20.10% 29.84% 2.6(2.6) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:20.10%

Trigger Attempt Success

  • trigger_pct:36.71%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Leeching Pestilence 8.0 0.0 60.3sec 60.3sec 17.54% 17.60% 0.0(0.0) 7.8

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1540.20

Stack Uptimes

  • leeching_pestilence_1:17.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Pillar of Frost 9.5 0.0 50.3sec 50.7sec 41.18% 41.17% 0.0(0.0) 9.1

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:41.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 58.1sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rime 23.6 0.0 18.8sec 18.8sec 9.55% 44.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:9.55%

Trigger Attempt Success

  • trigger_pct:45.01%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.7 17.2 36.2sec 15.0sec 67.02% 66.68% 17.2(17.2) 12.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:67.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=63723)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0011.0161.752 / 1.3223.0545.480
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.8457.27511.158 / 10.83415.81621.992

Resources

Resource Usage Type Count Total Average RPE APR
Decalang
frost_strike Runic Power 82.4 2059.3 25.0 25.0 10588.6
frostscythe Rune 33.2 33.2 1.0 1.0 307942.9
glacial_advance Rune 31.5 31.5 1.0 1.0 219525.5
howling_blast Rune 29.1 5.6 0.2 0.2 926865.3
obliterate Rune 52.4 104.8 2.0 2.0 73690.2
remorseless_winter Rune 17.4 17.4 1.0 1.0 167065.5
Resource Gains Type Count Total Average Overflow
howling_blast Runic Power 5.60 55.99 (2.69%) 10.00 0.00 0.00%
remorseless_winter Runic Power 17.35 173.55 (8.34%) 10.00 0.00 0.00%
glacial_advance Runic Power 31.46 314.57 (15.12%) 10.00 0.00 0.00%
frostscythe Runic Power 33.22 332.19 (15.97%) 10.00 0.00 0.00%
obliterate Runic Power 52.39 1047.72 (50.36%) 20.00 0.00 0.00%
Frost Fever Runic Power 28.14 140.69 (6.76%) 5.00 0.00 0.00%
Rune Regeneration Rune 150.09 150.09 (80.28%) 1.00 0.00 0.00%
Runic Empowerment Rune 20.60 20.60 (11.02%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 16.26 16.26 (8.70%) 1.00 0.00 0.00%
Over-Powered Runic Power 5.23 15.70 (0.75%) 3.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 4.62 4.57
Rune 0.41 0.43
Combat End Resource Mean Min Max
Runic Power 21.44 0.00 85.00
Rune 0.58 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.0%

Procs

Count Interval
Killing Machine: Obliterate 3.4 95.5sec
Killing Machine: Frostscythe 33.2 13.5sec
Rune ready 187.0 3.4sec

Statistics & Data Analysis

Fight Length
Sample Data Decalang Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Decalang Damage Per Second
Count 9999
Mean 176751.12
Minimum 159235.69
Maximum 197352.83
Spread ( max - min ) 38117.14
Range [ ( max - min ) / 2 * 100% ] 10.78%
Standard Deviation 5165.0403
5th Percentile 168437.89
95th Percentile 185540.03
( 95th Percentile - 5th Percentile ) 17102.14
Mean Distribution
Standard Deviation 51.6530
95.00% Confidence Intervall ( 176649.88 - 176852.36 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3280
0.1 Scale Factor Error with Delta=300 227735
0.05 Scale Factor Error with Delta=300 910942
0.01 Scale Factor Error with Delta=300 22773568
Priority Target DPS
Sample Data Decalang Priority Target Damage Per Second
Count 9999
Mean 176751.12
Minimum 159235.69
Maximum 197352.83
Spread ( max - min ) 38117.14
Range [ ( max - min ) / 2 * 100% ] 10.78%
Standard Deviation 5165.0403
5th Percentile 168437.89
95th Percentile 185540.03
( 95th Percentile - 5th Percentile ) 17102.14
Mean Distribution
Standard Deviation 51.6530
95.00% Confidence Intervall ( 176649.88 - 176852.36 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3280
0.1 Scale Factor Error with Delta=300 227735
0.05 Scale Factor Error with Delta=300 910942
0.01 Scale Factor Error with Delta=300 22773568
DPS(e)
Sample Data Decalang Damage Per Second (Effective)
Count 9999
Mean 176751.12
Minimum 159235.69
Maximum 197352.83
Spread ( max - min ) 38117.14
Range [ ( max - min ) / 2 * 100% ] 10.78%
Damage
Sample Data Decalang Damage
Count 9999
Mean 79514783.08
Minimum 58505666.44
Maximum 100518300.17
Spread ( max - min ) 42012633.72
Range [ ( max - min ) / 2 * 100% ] 26.42%
DTPS
Sample Data Decalang Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Decalang Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Decalang Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Decalang Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Decalang Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Decalang Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DecalangTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Decalang Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 9.45 pillar_of_frost
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking,if=buff.pillar_of_frost.up
7 8.00 use_item,slot=trinket1
8 1.00 potion,name=old_war
0.00 sindragosas_fury,if=buff.pillar_of_frost.up
0.00 obliteration
0.00 breath_of_sindragosa,if=runic_power>=50
9 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
A 0.00 call_action_list,name=shatter,if=talent.shattering_strikes.enabled
B 0.00 call_action_list,name=icytalons,if=talent.icy_talons.enabled
C 0.00 call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)
actions.core
# count action,conditions
0.00 remorseless_winter,if=artifact.frozen_soul.enabled
E 31.46 glacial_advance
0.00 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2
F 33.22 frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
0.00 obliterate,if=buff.killing_machine.react
G 52.39 obliterate
H 17.36 remorseless_winter
0.00 frostscythe,if=talent.frozen_pulse.enabled
0.00 howling_blast,if=talent.frozen_pulse.enabled
actions.shatter
# count action,conditions
K 37.52 frost_strike,if=debuff.razorice.stack=5
L 6.05 howling_blast,target_if=!dot.frost_fever.ticking
M 23.04 howling_blast,if=buff.rime.react
N 0.15 frost_strike,if=runic_power>=80
O 0.00 call_action_list,name=core
0.00 horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 horn_of_winter,if=!talent.breath_of_sindragosa.enabled
0.00 frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
P 44.70 frost_strike,if=!talent.breath_of_sindragosa.enabled
0.00 empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
Q 2.89 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
0.00 hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

Sample Sequence

0124567LEFGHPKFQGMFEGKPGPGMPPEGPHGKMFEPGKFGKMEP6HGKF87EPGKMGMFKEGPFFKEHPGKM6EFKGMHPGKME7GPGMPEFKHFPGEKF6FPLHKEGKFEPGKM7HGMPEQGGKFPPGKG6EGKMPFGKFEFFPPFGK7LEHPGG6KMPEKFHPGKMEGKMHEKGFGKMP7EG6KMFGHKPEFGKGKEFPHLFPGMPEKFG6KGP7EGKFQGMGGKPPEFKHGMPEGMPGPFEK6GPGMKH7EGKFPGKEFHPFPLEP

Sample Sequence Table

time name target resources buffs
Pre flask Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre food Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Decalang 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, unholy_strength, potion_of_the_old_war
0:00.000 use_item_ravaged_seed_pod Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:00.000 howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:01.247 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:02.263 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:03.282 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:04.299 remorseless_winter Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:05.317 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:06.334 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:07.351 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:08.369 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:08.369 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune bloodlust, pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:09.385 howling_blast Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, rime, unholy_strength, leeching_pestilence, potion_of_the_old_war
0:10.404 frostscythe Fluffy_Pillow 40.0/100: 40% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:11.422 glacial_advance Fluffy_Pillow 50.0/100: 50% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:12.439 obliterate Fluffy_Pillow 60.0/100: 60% runic_power | 2.0/6: 33% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:13.457 frost_strike Fluffy_Pillow 80.0/100: 80% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:14.475 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:15.494 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:16.511 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:17.529 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:18.546 howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, rime, potion_of_the_old_war
0:19.562 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:20.581 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune bloodlust, potion_of_the_old_war
0:21.599 Waiting 0.300 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune bloodlust, potion_of_the_old_war
0:21.899 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune bloodlust, potion_of_the_old_war
0:22.916 Waiting 1.100 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, potion_of_the_old_war
0:24.016 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:25.035 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:26.051 remorseless_winter Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:27.069 Waiting 1.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:28.669 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:29.686 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune bloodlust, rime, unholy_strength
0:30.704 howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune bloodlust, rime, unholy_strength
0:31.723 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune bloodlust, killing_machine, unholy_strength
0:32.741 glacial_advance Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:33.758 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:34.775 Waiting 0.700 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:35.475 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:36.496 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:37.513 Waiting 1.900 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:39.413 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength
0:40.431 Waiting 2.100 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:42.531 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
0:43.854 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune rime, unholy_strength
0:45.175 howling_blast Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune rime, unholy_strength
0:46.497 glacial_advance Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune unholy_strength
0:47.817 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune unholy_strength
0:49.138 pillar_of_frost Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune unholy_strength
0:49.138 remorseless_winter Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:50.461 Waiting 0.900 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
0:51.361 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
0:52.681 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
0:54.003 frostscythe Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
0:55.324 Waiting 2.500 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune pillar_of_frost
0:57.824 potion Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune pillar_of_frost
0:58.000 Waiting 1.800 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune pillar_of_frost, potion_of_the_old_war
0:59.800 use_item_ravaged_seed_pod Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune pillar_of_frost, potion_of_the_old_war
1:00.000 Waiting 0.100 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune pillar_of_frost, leeching_pestilence, potion_of_the_old_war
1:00.100 glacial_advance Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune pillar_of_frost, leeching_pestilence, potion_of_the_old_war
1:01.422 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune pillar_of_frost, leeching_pestilence, potion_of_the_old_war
1:02.743 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune pillar_of_frost, leeching_pestilence, potion_of_the_old_war
1:04.064 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, leeching_pestilence, potion_of_the_old_war
1:05.385 howling_blast Fluffy_Pillow 3.0/100: 3% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, leeching_pestilence, potion_of_the_old_war
1:06.706 Waiting 2.200 sec 3.0/100: 3% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
1:08.906 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, leeching_pestilence, potion_of_the_old_war
1:10.226 howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune rime, unholy_strength, potion_of_the_old_war
1:11.546 frostscythe Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_the_old_war
1:12.868 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_the_old_war
1:14.189 glacial_advance Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_the_old_war
1:15.511 Waiting 2.200 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_the_old_war
1:17.711 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune unholy_strength, potion_of_the_old_war
1:19.034 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_the_old_war
1:20.356 frostscythe Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_the_old_war
1:21.677 Waiting 4.800 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_the_old_war
1:26.477 frostscythe Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune killing_machine
1:27.798 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune
1:29.120 glacial_advance Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune
1:30.442 remorseless_winter Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune
1:31.764 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune
1:33.086 Waiting 2.200 sec 8.0/100: 8% runic_power | 0.0/6: 0% rune
1:35.286 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune
1:36.608 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune rime
1:37.930 howling_blast Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune rime
1:39.252 Waiting 0.700 sec 3.0/100: 3% runic_power | 1.0/6: 17% rune
1:39.952 pillar_of_frost Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune
1:40.138 Waiting 2.000 sec 3.0/100: 3% runic_power | 1.0/6: 17% rune pillar_of_frost
1:42.138 glacial_advance Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune pillar_of_frost
1:43.619 Waiting 0.400 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
1:44.019 frostscythe Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
1:45.341 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune pillar_of_frost
1:46.662 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 3.0/6: 50% rune pillar_of_frost
1:47.982 howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
1:49.301 Waiting 0.900 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:50.201 remorseless_winter Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:51.764 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:53.086 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
1:54.405 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
1:55.728 howling_blast Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength
1:57.050 glacial_advance Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
1:58.372 Waiting 1.400 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:59.772 use_item_ravaged_seed_pod Fluffy_Pillow 18.0/100: 18% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:00.000 Waiting 1.600 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, leeching_pestilence
2:01.600 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 3.0/6: 50% rune unholy_strength, leeching_pestilence
2:02.922 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune unholy_strength, leeching_pestilence
2:04.242 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune unholy_strength, leeching_pestilence
2:05.565 howling_blast Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune rime, unholy_strength, leeching_pestilence
2:06.886 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, leeching_pestilence
2:08.206 Waiting 2.200 sec 8.0/100: 8% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, leeching_pestilence
2:10.406 glacial_advance Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
2:11.727 frostscythe Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:13.047 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune unholy_strength
2:14.369 remorseless_winter Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune unholy_strength
2:15.692 Waiting 3.500 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune unholy_strength
2:19.192 frostscythe Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
2:20.515 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune unholy_strength
2:21.835 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 2.0/6: 33% rune unholy_strength
2:23.157 Waiting 4.800 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune unholy_strength
2:27.957 glacial_advance Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
2:29.279 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:30.600 frostscythe Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
2:31.921 pillar_of_frost Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune unholy_strength
2:31.921 Waiting 1.000 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:32.921 frostscythe Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
2:34.243 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune pillar_of_frost
2:35.565 Waiting 1.200 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune pillar_of_frost
2:36.765 howling_blast Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune pillar_of_frost
2:38.087 remorseless_winter Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost
2:39.410 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune pillar_of_frost
2:40.733 Waiting 0.200 sec 8.0/100: 8% runic_power | 1.0/6: 17% rune pillar_of_frost
2:40.933 glacial_advance Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune pillar_of_frost
2:42.457 Waiting 3.100 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune pillar_of_frost
2:45.557 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune pillar_of_frost
2:46.878 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune pillar_of_frost
2:48.200 Waiting 2.700 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune pillar_of_frost
2:50.900 frostscythe Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
2:52.222 Waiting 2.100 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune
2:54.322 glacial_advance Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune
2:55.644 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune
2:56.965 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune
2:58.287 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune rime
2:59.608 howling_blast Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune rime
3:00.929 use_item_ravaged_seed_pod Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune unholy_strength
3:00.929 remorseless_winter Fluffy_Pillow 8.0/100: 8% runic_power | 1.0/6: 17% rune unholy_strength, leeching_pestilence
3:02.249 Waiting 0.900 sec 18.0/100: 18% runic_power | 0.0/6: 0% rune unholy_strength, leeching_pestilence
3:03.149 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune unholy_strength, leeching_pestilence
3:04.469 howling_blast Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune rime, unholy_strength, leeching_pestilence
3:05.791 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune unholy_strength, leeching_pestilence
3:07.112 Waiting 0.200 sec 13.0/100: 13% runic_power | 1.0/6: 17% rune unholy_strength, leeching_pestilence
3:07.312 glacial_advance Fluffy_Pillow 13.0/100: 13% runic_power | 1.0/6: 17% rune unholy_strength, leeching_pestilence
3:08.821 empower_rune_weapon Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune unholy_strength, leeching_pestilence
3:08.821 obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 6.0/6: 100% rune unholy_strength, leeching_pestilence
3:10.143 obliterate Fluffy_Pillow 43.0/100: 43% runic_power | 4.0/6: 67% rune unholy_strength, leeching_pestilence
3:11.462 frost_strike Fluffy_Pillow 63.0/100: 63% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:12.785 frostscythe Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:14.107 frost_strike Fluffy_Pillow 53.0/100: 53% runic_power | 1.0/6: 17% rune unholy_strength
3:15.428 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 1.0/6: 17% rune
3:16.750 Waiting 0.900 sec 3.0/100: 3% runic_power | 1.0/6: 17% rune
3:17.650 obliterate Fluffy_Pillow 3.0/100: 3% runic_power | 3.0/6: 50% rune
3:18.970 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune
3:20.292 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune
3:21.612 Waiting 1.100 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune
3:22.712 pillar_of_frost Fluffy_Pillow 21.0/100: 21% runic_power | 0.0/6: 0% rune
3:22.921 Waiting 3.500 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost
3:26.421 glacial_advance Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:27.743 obliterate Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:29.065 frost_strike Fluffy_Pillow 56.0/100: 56% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
3:30.387 howling_blast Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
3:31.710 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
3:33.031 frostscythe Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:34.352 Waiting 0.900 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
3:35.252 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:36.573 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:37.894 frostscythe Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:39.215 Waiting 4.800 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
3:44.015 glacial_advance Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine
3:45.338 frostscythe Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune killing_machine
3:46.659 frostscythe Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:47.981 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune unholy_strength
3:49.303 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune unholy_strength
3:50.625 Waiting 2.200 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
3:52.825 frostscythe Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:54.147 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune unholy_strength
3:55.467 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune unholy_strength
3:56.789 Waiting 3.900 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune unholy_strength
4:00.689 use_item_ravaged_seed_pod Fluffy_Pillow 16.0/100: 16% runic_power | 0.0/6: 0% rune
4:00.929 Waiting 0.700 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune leeching_pestilence
4:01.629 howling_blast Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune leeching_pestilence
4:02.950 glacial_advance Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune leeching_pestilence
4:04.272 remorseless_winter Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune leeching_pestilence
4:05.595 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune leeching_pestilence
4:06.917 Waiting 3.400 sec 21.0/100: 21% runic_power | 1.0/6: 17% rune leeching_pestilence
4:10.317 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 3.0/6: 50% rune leeching_pestilence
4:11.638 obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 2.0/6: 33% rune
4:12.960 pillar_of_frost Fluffy_Pillow 61.0/100: 61% runic_power | 0.0/6: 0% rune killing_machine, rime
4:12.960 frost_strike Fluffy_Pillow 61.0/100: 61% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, rime
4:14.282 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, rime, unholy_strength
4:15.603 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
4:16.924 Waiting 2.200 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
4:19.124 glacial_advance Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
4:20.446 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
4:21.767 frostscythe Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
4:23.089 Waiting 1.000 sec 16.0/100: 16% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:24.089 remorseless_winter Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:25.592 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
4:26.913 Waiting 1.000 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
4:27.913 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
4:29.235 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
4:30.556 howling_blast Fluffy_Pillow 1.0/100: 1% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
4:31.875 Waiting 0.200 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune pillar_of_frost
4:32.075 glacial_advance Fluffy_Pillow 1.0/100: 1% runic_power | 1.0/6: 17% rune pillar_of_frost
4:33.623 Waiting 3.100 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune
4:36.723 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune killing_machine
4:38.044 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune rime
4:39.366 howling_blast Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune rime
4:40.686 Waiting 3.400 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune
4:44.086 remorseless_winter Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune
4:45.593 glacial_advance Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune unholy_strength
4:46.915 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune unholy_strength
4:48.238 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune unholy_strength
4:49.560 Waiting 4.700 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:54.260 frostscythe Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
4:55.581 obliterate Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune unholy_strength
4:56.902 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 0.0/6: 0% rune rime, unholy_strength
4:58.224 howling_blast Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune rime, unholy_strength
4:59.545 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune unholy_strength
5:00.865 use_item_ravaged_seed_pod Fluffy_Pillow 1.0/100: 1% runic_power | 0.0/6: 0% rune unholy_strength
5:00.929 Waiting 2.100 sec 1.0/100: 1% runic_power | 0.0/6: 0% rune unholy_strength, leeching_pestilence
5:03.029 glacial_advance Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune unholy_strength, leeching_pestilence
5:04.351 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune unholy_strength, leeching_pestilence
5:05.673 pillar_of_frost Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune killing_machine, rime, unholy_strength, leeching_pestilence
5:05.673 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, rime, unholy_strength, leeching_pestilence
5:06.993 howling_blast Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, rime, unholy_strength, leeching_pestilence
5:08.312 frostscythe Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence
5:09.634 Waiting 2.200 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, leeching_pestilence
5:11.834 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
5:13.156 remorseless_winter Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:14.478 frost_strike Fluffy_Pillow 56.0/100: 56% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
5:15.799 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
5:17.120 glacial_advance Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
5:18.441 Waiting 2.200 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost
5:20.641 frostscythe Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost
5:21.964 obliterate Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune pillar_of_frost
5:23.284 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune pillar_of_frost
5:24.604 Waiting 4.800 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost
5:29.404 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune unholy_strength
5:30.724 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:32.045 glacial_advance Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:33.367 frostscythe Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:34.687 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune unholy_strength
5:36.008 remorseless_winter Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:37.328 Waiting 0.900 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
5:38.228 howling_blast Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:39.548 frostscythe Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:40.868 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune unholy_strength
5:42.189 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune unholy_strength
5:43.511 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune rime
5:44.833 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune
5:46.153 Waiting 0.800 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
5:46.953 glacial_advance Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:48.274 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:49.594 frostscythe Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:50.916 Waiting 4.900 sec 11.0/100: 11% runic_power | 1.0/6: 17% rune unholy_strength
5:55.816 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 3.0/6: 50% rune unholy_strength
5:57.137 pillar_of_frost Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune unholy_strength
5:57.137 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
5:58.459 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
5:59.779 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:01.100 use_item_ravaged_seed_pod Fluffy_Pillow 6.0/100: 6% runic_power | 0.0/6: 0% rune pillar_of_frost
6:01.100 Waiting 3.500 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune pillar_of_frost, leeching_pestilence
6:04.600 glacial_advance Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, leeching_pestilence
6:05.921 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune pillar_of_frost, leeching_pestilence
6:07.242 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence
6:08.565 frostscythe Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence
6:09.886 empower_rune_weapon Fluffy_Pillow 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, leeching_pestilence
6:09.886 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 6.0/6: 100% rune pillar_of_frost, unholy_strength, leeching_pestilence
6:11.207 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 4.0/6: 67% rune pillar_of_frost, rime, unholy_strength
6:12.529 obliterate Fluffy_Pillow 41.0/100: 41% runic_power | 4.0/6: 67% rune pillar_of_frost, unholy_strength
6:13.848 obliterate Fluffy_Pillow 61.0/100: 61% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:15.171 frost_strike Fluffy_Pillow 81.0/100: 81% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:16.495 frost_strike Fluffy_Pillow 56.0/100: 56% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:17.816 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune unholy_strength
6:19.140 glacial_advance Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
6:20.462 frostscythe Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:21.785 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune unholy_strength
6:23.105 remorseless_winter Fluffy_Pillow 1.0/100: 1% runic_power | 1.0/6: 17% rune unholy_strength
6:24.426 Waiting 3.100 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune unholy_strength
6:27.526 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune
6:28.848 howling_blast Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune rime
6:30.170 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune
6:31.490 Waiting 0.600 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune
6:32.090 glacial_advance Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune
6:33.640 Waiting 2.700 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune
6:36.340 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune
6:37.660 howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune rime
6:38.981 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune
6:40.303 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune
6:41.625 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune
6:42.949 Waiting 2.100 sec 6.0/100: 6% runic_power | 0.0/6: 0% rune killing_machine
6:45.049 frostscythe Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune killing_machine
6:46.371 glacial_advance Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune
6:47.693 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune
6:49.014 pillar_of_frost Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune
6:49.137 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:50.459 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:51.780 Waiting 2.100 sec 1.0/100: 1% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:53.880 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:55.203 howling_blast Fluffy_Pillow 21.0/100: 21% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
6:56.525 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:57.848 remorseless_winter Fluffy_Pillow 1.0/100: 1% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:59.169 Waiting 1.700 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:00.869 use_item_ravaged_seed_pod Fluffy_Pillow 11.0/100: 11% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:01.100 Waiting 1.500 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, leeching_pestilence
7:02.600 glacial_advance Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, leeching_pestilence
7:03.920 Waiting 1.400 sec 21.0/100: 21% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, leeching_pestilence
7:05.320 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune pillar_of_frost, leeching_pestilence
7:06.644 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, leeching_pestilence
7:07.965 Waiting 3.500 sec 16.0/100: 16% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, leeching_pestilence
7:11.465 frostscythe Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
7:12.786 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune unholy_strength
7:14.106 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune unholy_strength
7:15.429 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune unholy_strength
7:16.750 glacial_advance Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune unholy_strength
7:18.070 Waiting 2.100 sec 21.0/100: 21% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
7:20.170 frostscythe Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
7:21.492 remorseless_winter Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune unholy_strength
7:22.814 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune killing_machine
7:24.136 frostscythe Fluffy_Pillow 21.0/100: 21% runic_power | 1.0/6: 17% rune killing_machine
7:25.458 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune
7:26.782 Waiting 2.200 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune
7:28.982 howling_blast Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune
7:30.305 glacial_advance Fluffy_Pillow 21.0/100: 21% runic_power | 1.0/6: 17% rune
7:31.628 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 24436 22730 10992 (8437)
Agility 8278 7953 0
Stamina 29109 29109 18254
Intellect 4751 4426 0
Spirit 2 2 0
Health 1746540 1746540 0
Runic Power 100 100 0
Rune 6 6 0
Crit 23.65% 22.58% 6153
Haste 13.82% 13.82% 4492
Swing Speed 27.48% 27.48% 4492
Damage / Heal Versatility 2.93% 2.93% 1174
Attack Power 24436 22730 0
Mastery 39.26% 39.26% 6360
Armor 4086 4086 3967
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 848.00
Local Head Skoldiir Helm
ilevel: 840, stats: { 542 Armor, +1182 StrInt, +1773 Sta, +871 Crit, +386 Mastery }
Local Neck Krakentooth Necklace
ilevel: 875, stats: { +1381 Sta, +1382 Mastery, +633 Vers }, gems: { +100 Mastery }
Local Shoulders Tremorguard Pauldrons
ilevel: 840, stats: { 501 Armor, +886 StrInt, +1329 Sta, +572 Mastery, +370 Crit }
Local Chest Skoldiir Breastplate
ilevel: 840, stats: { 668 Armor, +1182 StrInt, +1773 Sta, +791 Crit, +467 Mastery }
Local Waist Nightsfall Girdle
ilevel: 835, stats: { 371 Armor, +846 StrInt, +1269 Sta, +602 Haste, +324 Mastery }
Local Legs Storm-Battered Legplates
ilevel: 850, stats: { 597 Armor, +1945 Sta, +1297 StrInt, +764 Haste, +540 Mastery }
Local Feet Trampling Warboots
ilevel: 850, stats: { 469 Armor, +1459 Sta, +973 StrInt, +553 Mastery, +426 Haste }
Local Wrists Nightsfall Vambraces
ilevel: 835, stats: { 289 Armor, +635 StrInt, +952 Sta, +471 Haste, +223 Mastery }
Local Hands Rumblestone Gauntlets
ilevel: 825, stats: { 404 Armor, +771 StrInt, +1157 Sta, +541 Vers, +350 Haste }
Local Finger1 Band of Decaying Rubies
ilevel: 835, stats: { +952 Sta, +1042 Crit, +695 Haste }, gems: { +150 Mastery }
Local Finger2 Cursed Warden's Keepsake
ilevel: 860, stats: { +1201 Sta, +1089 Crit, +817 Mastery }, gems: { +150 Mastery }
Local Trinket1 Ravaged Seed Pod
ilevel: 850, stats: { +932 Haste }, gems: { +100 Mastery }
Local Trinket2 Ironrune Charm
ilevel: 845, stats: { +1177 Str, +915 Crit }
Local Back Cloak of Fading Echoes
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +252 Haste, +455 Crit }
Local Main Hand Blades of the Fallen Prince
ilevel: 873, weapon: { 4083 - 7584, 2.6 }, stats: { +689 Str, +1033 Sta, +310 Crit, +298 Mastery }, enchant: rune_of_the_fallen_crusader, relics: { +43 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 873, weapon: { 4083 - 7584, 2.6 }, stats: { +689 Str, +1033 Sta, +310 Crit, +298 Mastery }, enchant: rune_of_razorice
Local Tabard Stormwind Tabard
ilevel: 600

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Decalang"
origin="https://eu.api.battle.net/wow/character/hyjal/Decalang/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/92/114541916-avatar.jpg"
level=110
race=draenei
role=attack
position=back
professions=jewelcrafting=760/mining=769
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!0002202
artifact=12:0:0:0:0:108:3:109:3:113:3:114:3:115:3:119:1:120:1:122:1:1091:1:1332:1
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/use_item,slot=trinket1
actions+=/potion,name=old_war
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up
actions+=/obliteration
actions+=/breath_of_sindragosa,if=runic_power>=50
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=shatter,if=talent.shattering_strikes.enabled
actions+=/call_action_list,name=icytalons,if=talent.icy_talons.enabled
actions+=/call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)

actions.bos=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/call_action_list,name=core
actions.bos+=/horn_of_winter
actions.bos+=/empower_rune_weapon,if=runic_power<=70
actions.bos+=/hungering_rune_weapon
actions.bos+=/howling_blast,if=buff.rime.react

actions.core=remorseless_winter,if=artifact.frozen_soul.enabled
actions.core+=/glacial_advance
actions.core+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.core+=/remorseless_winter,if=spell_targets.remorseless_winter>=2
actions.core+=/frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
actions.core+=/obliterate,if=buff.killing_machine.react
actions.core+=/obliterate
actions.core+=/remorseless_winter
actions.core+=/frostscythe,if=talent.frozen_pulse.enabled
actions.core+=/howling_blast,if=talent.frozen_pulse.enabled

actions.generic=howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/howling_blast,if=buff.rime.react
actions.generic+=/frost_strike,if=runic_power>=80
actions.generic+=/call_action_list,name=core
actions.generic+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.icytalons=frost_strike,if=buff.icy_talons.remains<1.5
actions.icytalons+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.icytalons+=/howling_blast,if=buff.rime.react
actions.icytalons+=/frost_strike,if=runic_power>=80|buff.icy_talons.stack<3
actions.icytalons+=/call_action_list,name=core
actions.icytalons+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.shatter=frost_strike,if=debuff.razorice.stack=5
actions.shatter+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.shatter+=/howling_blast,if=buff.rime.react
actions.shatter+=/frost_strike,if=runic_power>=80
actions.shatter+=/call_action_list,name=core
actions.shatter+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

head=skoldiir_helm,id=134182,bonus_id=3396/1502/3337
neck=krakentooth_necklace,id=141473,bonus_id=1808/1487/3337,gems=100mastery
shoulders=tremorguard_pauldrons,id=134517,bonus_id=1727/1492/1813
back=cloak_of_fading_echoes,id=134405,bonus_id=1727/1492/1813
chest=skoldiir_breastplate,id=134179,bonus_id=1727/1502/1813
tabard=stormwind_tabard,id=118365
wrists=nightsfall_vambraces,id=139062,bonus_id=3432/1497/1674
hands=rumblestone_gauntlets,id=137355,bonus_id=1726/1477
waist=nightsfall_girdle,id=139057,bonus_id=3432/1497/1674
legs=stormbattered_legplates,id=139230,bonus_id=1807/1472
feet=trampling_warboots,id=139234,bonus_id=1807/1472
finger1=band_of_decaying_rubies,id=137438,bonus_id=1726/1808/1487/3339,gems=150mastery
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1808/1472,gems=150mastery
trinket1=ravaged_seed_pod,id=139320,bonus_id=1807/1808/1472,gems=100mastery
trinket2=ironrune_charm,id=134190,bonus_id=3432/603/1507/3336
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=139250/136719/141267/0,relic_id=1807:1472/1727:1492:1813/3432:1502:3336/0,enchant=rune_of_the_fallen_crusader
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_razorice

# Gear Summary
# gear_ilvl=847.88
# gear_strength=10992
# gear_stamina=18254
# gear_crit_rating=6153
# gear_haste_rating=4492
# gear_mastery_rating=6360
# gear_versatility_rating=1174
# gear_armor=3967

Ethila

Ethila : 204236 dps

  • Race: Human
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
204236.3 204236.3 121.9 / 0.060% 24258.1 / 11.9% 44557.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.6 4.6 Runic Power 29.81% 35.2 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced
Talents
  • 15: Shattering Strikes (Frost Death Knight)
  • 30: Freezing Fog (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Frostscythe (Frost Death Knight)
  • 100: Glacial Advance (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • mining: 790
  • jewelcrafting: 766

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ethila 204236
auto_attack_mh 11348 5.6% 232.1 1.95sec 22021 11342 Direct 232.1 20118 40235 22021 28.5% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 232.05 232.05 0.00 0.00 1.9416 0.0000 5109981.20 7512156.39 31.98 11341.53 11341.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.83 52.50% 20118.15 17532 22646 20119.73 19482 20768 2451011 3603219 31.98
crit 66.09 28.48% 40234.58 35064 45291 40236.84 38494 42079 2658970 3908938 31.98
miss 44.13 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5693 2.8% 232.1 1.95sec 11048 5690 Direct 232.1 10087 20175 11048 28.5% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 232.05 232.05 0.00 0.00 1.9416 0.0000 2563721.59 3768913.58 31.98 5690.14 5690.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.90 52.53% 10087.12 8766 11323 10087.93 9788 10429 1229600 1807628 31.98
crit 66.13 28.50% 20175.01 17532 22646 20176.38 19227 21090 1334122 1961285 31.98
miss 44.03 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Crystalline Swords 10987 5.4% 67.1 13.32sec 73740 0 Direct 67.1 57396 114769 73740 28.5% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.09 67.09 0.00 0.00 0.0000 0.0000 4947381.18 4947381.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.98 71.51% 57395.79 42767 71413 57403.33 52478 62208 2753838 2753838 0.00
crit 19.11 28.49% 114769.10 85533 142825 114799.37 97390 134848 2193544 2193544 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 13520 (19479) 6.6% (9.6%) 28.9 15.69sec 303815 0 Periodic 149.0 31813 63636 40882 28.5% 0.0% 98.0%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.88 0.00 149.01 149.01 0.0000 2.9629 6091946.09 6091946.09 0.00 19875.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.5 71.50% 31812.50 9 40913 31817.51 29957 33716 3389360 3389360 0.00
crit 42.5 28.50% 63636.05 33 81827 63652.82 56870 71152 2702586 2702586 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Hypothermia 5959 2.9% 14.9 28.09sec 180465 0 Direct 14.9 140440 281076 180467 28.5% 0.0%  

Stats details: hypothermia

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 2683348.36 2683348.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.64 71.54% 140440.32 106916 178531 140422.95 0 176908 1493911 1493911 0.00
crit 4.23 28.46% 281076.21 213833 357063 276567.21 0 357063 1189437 1189437 0.00
 
 

Action details: hypothermia

Static Values
  • id:228322
  • school:frost
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228322
  • name:Hypothermia
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage.
 
Frost Strike 0 (56651) 0.0% (27.8%) 82.5 5.43sec 309268 245543

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.46 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00 245543.47 245543.47
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.obliteration.up&!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 33645 16.5% 82.5 5.43sec 183675 0 Direct 82.5 143028 285977 183674 28.4% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.46 82.46 0.00 0.00 0.0000 0.0000 15145801.17 15145801.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.01 71.56% 143027.74 90879 197999 143062.97 128888 159912 8440243 8440243 0.00
crit 23.45 28.44% 285977.01 181759 395999 285996.08 236701 337907 6705558 6705558 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 23006 11.3% 82.5 5.43sec 125593 0 Direct 82.5 97741 195482 125592 28.5% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.46 82.46 0.00 0.00 0.0000 0.0000 10356343.32 10356343.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.96 71.50% 97741.17 60256 128704 97769.27 91209 106454 5763020 5763020 0.00
crit 23.50 28.50% 195482.13 120511 257408 195531.30 165521 229647 4593324 4593324 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frostscythe 21795 10.7% 34.9 12.81sec 281008 222442 Direct 34.9 0 281010 281010 100.0% 0.0%  

Stats details: frostscythe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.93 34.93 0.00 0.00 1.2633 0.0000 9815467.46 9815467.46 0.00 222441.81 222441.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 34.93 100.00% 281010.01 222580 346387 281012.77 260500 299970 9815467 9815467 0.00
 
 

Action details: frostscythe

Static Values
  • id:207230
  • school:frost
  • resource:rune
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
Spelldata
  • id:207230
  • name:Frostscythe
  • school:frost
  • tooltip:
  • description:A sweeping attack that strikes all enemies in front of you for $sw1 Frost damage. This attack benefits from Killing Machine. Critical strikes with Frostscythe deal {$s3=4} times normal damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.35
 
Glacial Advance 0 (16069) 0.0% (7.9%) 32.0 14.24sec 226324 179452

Stats details: glacial_advance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.96 0.00 0.00 0.00 1.2612 0.0000 0.00 0.00 0.00 179451.65 179451.65
 
 

Action details: glacial_advance

Static Values
  • id:194913
  • school:frost
  • resource:rune
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194913
  • name:Glacial Advance
  • school:shadow
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, each dealing {$195975s1=0} Frost damage to enemies near their eruption point.
 
    Glacial Advance (_damage) 16069 7.9% 32.0 14.24sec 226324 0 Direct 32.0 176149 352531 226320 28.4% 0.0%  

Stats details: glacial_advance_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.96 31.96 0.00 0.00 0.0000 0.0000 7234413.66 7234413.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.87 71.55% 176149.34 133645 223164 176196.61 161143 198573 4028949 4028949 0.00
crit 9.09 28.45% 352530.57 267291 446328 352680.72 279764 446328 3205465 3205465 0.00
 
 

Action details: glacial_advance_damage

Static Values
  • id:195975
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195975
  • name:Glacial Advance
  • school:frost
  • tooltip:
  • description:Summon glacial spikes from the ground that advance forward, damaging enemies near their eruption point for {$s1=0} frost damage.
 
Howling Blast 10844 5.3% 28.9 15.69sec 168884 135001 Direct 28.9 131357 263172 168880 28.5% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.88 28.88 0.00 0.00 1.2510 0.0000 4877981.15 4877981.15 0.00 135000.72 135000.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.66 71.53% 131357.25 29402 196385 130820.94 66974 166849 2713969 2713969 0.00
crit 8.22 28.47% 263172.11 58804 392769 262054.97 0 385628 2164012 2164012 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Obliterate 0 (20014) 0.0% (9.8%) 51.9 8.65sec 173399 138583

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.93 0.00 0.00 0.00 1.2512 0.0000 0.00 0.00 0.00 138583.48 138583.48
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 12123 5.9% 51.9 8.65sec 105036 0 Direct 51.9 72277 170598 105040 33.3% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.93 51.93 0.00 0.00 0.0000 0.0000 5454017.07 8017921.72 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.62 66.68% 72277.40 62690 80628 72290.42 68575 76174 2502571 3679016 31.98
crit 17.30 33.32% 170597.55 147949 190282 170612.98 157696 185714 2951446 4338905 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
    Obliterate Off-Hand 7891 3.9% 51.9 8.65sec 68363 0 Direct 51.9 46983 110888 68364 33.5% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.93 51.93 0.00 0.00 0.0000 0.0000 3549751.60 5218471.10 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.55 66.54% 46983.03 40750 52410 46990.72 44739 49332 1623413 2386571 31.98
crit 17.37 33.46% 110887.62 96171 123687 110892.12 101601 119524 1926339 2831900 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
Potion of the Old War 7878 3.8% 23.1 3.74sec 150980 0 Direct 23.1 117582 235163 150983 28.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.13 23.13 0.00 0.00 0.0000 0.0000 3492596.77 5134448.08 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.56 71.60% 117581.72 117582 117582 117581.72 117582 117582 1947419 2862890 31.98
crit 6.57 28.40% 235163.43 235163 235163 234951.76 0 235163 1545178 2271558 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice 4884 2.4% 357.2 1.26sec 6155 0 Direct 357.2 4787 9574 6155 28.6% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 357.21 357.21 0.00 0.00 0.0000 0.0000 2198596.99 2198596.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 255.14 71.43% 4787.15 3967 5636 4787.75 4622 4958 1221399 1221399 0.00
crit 102.07 28.57% 9573.79 7933 11272 9575.09 9090 10135 977198 977198 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 7992 3.9% 17.4 26.10sec 206792 163322 Periodic 137.9 20323 40645 26104 28.4% 0.0% 30.6%

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.41 0.00 137.90 137.90 1.2662 1.0000 3599783.60 3599783.60 0.00 22506.67 163322.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.7 71.55% 20323.25 15396 25709 20327.41 18334 21972 2005404 2005404 0.00
crit 39.2 28.45% 40644.52 30792 51417 40651.82 35086 47083 1594380 1594380 0.00
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.frozen_soul.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
Rend Flesh 4459 2.2% 56.0 8.10sec 35885 0 Periodic 191.0 8191 16375 10520 28.5% 0.0% 81.6%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.98 0.00 190.95 190.95 0.0000 1.9259 2008842.35 2008842.35 0.00 5462.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.6 71.54% 8190.84 8 8422 8191.37 7781 8422 1118883 1118883 0.00
crit 54.3 28.46% 16374.89 17 16844 16376.86 14925 16844 889960 889960 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for {$221770s1=5418 to 5988} Physical damage over {$221770d=8 seconds}, stacking up to {$221770u=1} times.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:8278.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Sindragosa's Fury 6144 3.0% 2.0 0.00sec 1361987 1049297 Direct 2.0 1063939 2125651 1362071 28.1% 0.0%  

Stats details: sindragosas_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2985 0.0000 2723974.78 2723974.78 0.00 1049296.91 1049296.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.44 71.93% 1063938.65 852473 1190209 980277.17 0 1190209 1530535 1530535 0.00
crit 0.56 28.07% 2125650.58 1881728 2380418 1025794.86 0 2380418 1193440 1193440 0.00
 
 

Action details: sindragosas_fury

Static Values
  • id:190778
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pillar_of_frost.up
Spelldata
  • id:190778
  • name:Sindragosa's Fury
  • school:frost
  • tooltip:
  • description:Summons Sindragosa, who breathes frost on all enemies within {$s1=40} yd in front of you, dealing {$190780s1=0} Frost damage and slowing movement speed by {$190780s2=50}% for {$190780d=10 seconds}.
 
Simple Action Stats Execute Interval
Ethila
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.9 180.72sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<=70
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:false
  • if_expr:
 
Pillar of Frost 9.6 49.74sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 30.4 14.83sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 30.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ethila
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.78% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Killing Machine 38.8 3.0 11.7sec 10.8sec 20.59% 30.64% 3.0(3.0) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:20.59%

Trigger Attempt Success

  • trigger_pct:31.75%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 9.6 0.0 49.3sec 49.7sec 41.93% 41.97% 0.0(0.0) 9.2

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:41.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 58.1sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rime 23.3 0.0 19.0sec 19.0sec 9.37% 44.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:9.37%

Trigger Attempt Success

  • trigger_pct:44.80%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.8 17.6 35.9sec 14.8sec 67.64% 67.17% 17.6(17.6) 12.1

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:67.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=76662)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.9991.967 / 1.9973.8925.433
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
8.97611.28215.072 / 14.88219.67427.553

Resources

Resource Usage Type Count Total Average RPE APR
Ethila
frost_strike Runic Power 82.5 2061.5 25.0 25.0 12370.7
frostscythe Rune 34.9 34.9 1.0 1.0 281013.2
glacial_advance Rune 32.0 32.0 1.0 1.0 226322.8
howling_blast Rune 28.9 5.7 0.2 0.2 853211.9
obliterate Rune 51.9 103.9 2.0 2.0 86699.0
remorseless_winter Rune 17.4 17.4 1.0 1.0 206796.0
Resource Gains Type Count Total Average Overflow
howling_blast Runic Power 5.72 57.17 (2.75%) 10.00 0.00 0.00%
remorseless_winter Runic Power 17.41 174.07 (8.37%) 10.00 0.00 0.00%
glacial_advance Runic Power 31.97 319.65 (15.37%) 10.00 0.00 0.00%
frostscythe Runic Power 34.93 349.29 (16.80%) 10.00 0.00 0.00%
obliterate Runic Power 51.93 1038.51 (49.94%) 20.00 0.00 0.00%
Frost Fever Runic Power 28.13 140.65 (6.76%) 5.00 0.00 0.00%
Rune Regeneration Rune 151.65 151.65 (80.47%) 1.00 0.00 0.00%
Runic Empowerment Rune 20.56 20.56 (10.91%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 16.24 16.24 (8.62%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 4.61 4.58
Rune 0.42 0.43
Combat End Resource Mean Min Max
Runic Power 17.64 0.00 80.00
Rune 0.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.0%

Procs

Count Interval
Killing Machine: Obliterate 3.6 91.2sec
Killing Machine: Frostscythe 34.9 12.9sec
Rune ready 188.4 3.3sec

Statistics & Data Analysis

Fight Length
Sample Data Ethila Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Ethila Damage Per Second
Count 9999
Mean 204236.33
Minimum 183173.44
Maximum 229643.56
Spread ( max - min ) 46470.11
Range [ ( max - min ) / 2 * 100% ] 11.38%
Standard Deviation 6219.3371
5th Percentile 194382.92
95th Percentile 215022.70
( 95th Percentile - 5th Percentile ) 20639.77
Mean Distribution
Standard Deviation 62.1965
95.00% Confidence Intervall ( 204114.43 - 204358.24 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3562
0.1 Scale Factor Error with Delta=300 330196
0.05 Scale Factor Error with Delta=300 1320784
0.01 Scale Factor Error with Delta=300 33019604
Priority Target DPS
Sample Data Ethila Priority Target Damage Per Second
Count 9999
Mean 204236.33
Minimum 183173.44
Maximum 229643.56
Spread ( max - min ) 46470.11
Range [ ( max - min ) / 2 * 100% ] 11.38%
Standard Deviation 6219.3371
5th Percentile 194382.92
95th Percentile 215022.70
( 95th Percentile - 5th Percentile ) 20639.77
Mean Distribution
Standard Deviation 62.1965
95.00% Confidence Intervall ( 204114.43 - 204358.24 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3562
0.1 Scale Factor Error with Delta=300 330196
0.05 Scale Factor Error with Delta=300 1320784
0.01 Scale Factor Error with Delta=300 33019604
DPS(e)
Sample Data Ethila Damage Per Second (Effective)
Count 9999
Mean 204236.33
Minimum 183173.44
Maximum 229643.56
Spread ( max - min ) 46470.11
Range [ ( max - min ) / 2 * 100% ] 11.38%
Damage
Sample Data Ethila Damage
Count 9999
Mean 91853948.36
Minimum 68798287.96
Maximum 117751617.89
Spread ( max - min ) 48953329.93
Range [ ( max - min ) / 2 * 100% ] 26.65%
DTPS
Sample Data Ethila Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ethila Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ethila Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ethila Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ethila Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ethila Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EthilaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ethila Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 9.63 pillar_of_frost
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking,if=buff.pillar_of_frost.up
7 1.00 potion,name=old_war
8 2.00 sindragosas_fury,if=buff.pillar_of_frost.up
0.00 obliteration
0.00 breath_of_sindragosa,if=runic_power>=50
9 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
A 0.00 call_action_list,name=shatter,if=talent.shattering_strikes.enabled
B 0.00 call_action_list,name=icytalons,if=talent.icy_talons.enabled
C 0.00 call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)
actions.core
# count action,conditions
0.00 remorseless_winter,if=artifact.frozen_soul.enabled
E 31.97 glacial_advance
0.00 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2
F 34.93 frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
0.00 obliterate,if=buff.killing_machine.react
G 51.93 obliterate
H 17.41 remorseless_winter
0.00 frostscythe,if=talent.frozen_pulse.enabled
0.00 howling_blast,if=talent.frozen_pulse.enabled
actions.shatter
# count action,conditions
K 42.52 frost_strike,if=debuff.razorice.stack=5
L 6.17 howling_blast,target_if=!dot.frost_fever.ticking
M 22.72 howling_blast,if=buff.rime.react
N 0.06 frost_strike,if=runic_power>=80
O 0.00 call_action_list,name=core
0.00 horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 horn_of_winter,if=!talent.breath_of_sindragosa.enabled
0.00 frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
P 39.88 frost_strike,if=!talent.breath_of_sindragosa.enabled
0.00 empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
Q 2.90 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
0.00 hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

Sample Sequence

0124568LEFKGMFHKGPQEFKGGPMGPGKEPHFKGMEPFGK6EHPGK7GPEKLHPFGKEFPFHKLEP6FGKEPFHKFLPGKEFHKGPELKF6EKGHPGKMEGKGPHEKGKFPLQEKGG6MHKPFGKEPFGKMGMEHPPGPGKEFGK6HPEFKLGPEFKHGKEPLFHKEFPF6GKMG8PEGPHKGMEPFFKHGKMEFP6FGKEHPFFFKFELPQFKGGMHKEPGMKFP6GMGKMEPFHKGKMEFPGKHEFPGPGKE6LGKPHG

Sample Sequence Table

time name target resources buffs
Pre flask Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre food Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Ethila 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 sindragosas_fury Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune pillar_of_frost, potion_of_the_old_war
0:01.230 howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:02.229 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:03.229 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:04.226 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:05.225 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:06.226 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, rime, potion_of_the_old_war
0:07.226 frostscythe Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:08.225 remorseless_winter Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:09.225 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:10.223 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:11.223 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:12.222 empower_rune_weapon Fluffy_Pillow 15.0/100: 15% runic_power | 0.0/6: 0% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:12.222 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 6.0/6: 100% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:13.222 frostscythe Fluffy_Pillow 25.0/100: 25% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, pillar_of_frost, potion_of_the_old_war
0:14.223 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 4.0/6: 67% rune bloodlust, pillar_of_frost, potion_of_the_old_war
0:15.221 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 4.0/6: 67% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:16.222 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:17.223 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:18.222 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, rime, unholy_strength, potion_of_the_old_war
0:19.221 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, unholy_strength, potion_of_the_old_war
0:20.220 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, potion_of_the_old_war
0:21.222 Waiting 0.700 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, potion_of_the_old_war
0:21.922 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, potion_of_the_old_war
0:22.923 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, potion_of_the_old_war
0:23.922 Waiting 1.600 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:25.522 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:26.523 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:27.522 Waiting 0.500 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:28.022 remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:29.226 Waiting 2.600 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:31.826 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength
0:32.826 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:33.825 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength
0:34.824 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune bloodlust, rime, unholy_strength
0:35.824 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:36.822 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:37.822 Waiting 1.000 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength
0:38.822 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength
0:39.824 Waiting 2.200 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength
0:42.024 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
0:43.323 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
0:44.620 Waiting 1.200 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
0:45.820 pillar_of_frost Fluffy_Pillow 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
0:46.000 Waiting 1.000 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
0:47.000 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:48.510 remorseless_winter Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:49.808 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
0:51.106 Waiting 4.300 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:55.406 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
0:56.706 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:58.003 potion Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
0:58.003 Waiting 1.300 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, potion_of_the_old_war
0:59.303 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, potion_of_the_old_war
1:00.602 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, potion_of_the_old_war
1:01.901 Waiting 2.100 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, potion_of_the_old_war
1:04.001 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, potion_of_the_old_war
1:05.297 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, potion_of_the_old_war
1:06.597 howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_the_old_war
1:07.895 Waiting 0.400 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_the_old_war
1:08.295 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength, potion_of_the_old_war
1:09.810 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_the_old_war
1:11.108 Waiting 1.500 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_the_old_war
1:12.608 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_the_old_war
1:13.905 Waiting 2.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength, potion_of_the_old_war
1:16.605 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength, potion_of_the_old_war
1:17.904 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_the_old_war
1:19.201 Waiting 2.100 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, potion_of_the_old_war
1:21.301 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_the_old_war
1:22.599 frostscythe Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, potion_of_the_old_war
1:23.898 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune unholy_strength
1:25.198 Waiting 0.300 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
1:25.498 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
1:26.796 Waiting 3.100 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
1:29.896 remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
1:31.193 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
1:32.491 howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
1:33.788 Waiting 0.300 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
1:34.088 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
1:35.541 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
1:36.838 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 0.0/6: 0% rune unholy_strength
1:37.000 Waiting 2.600 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:39.600 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
1:40.900 Waiting 1.500 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
1:42.400 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
1:43.700 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:44.999 Waiting 2.200 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
1:47.199 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost
1:48.498 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost
1:49.798 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
1:51.097 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost
1:52.395 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
1:53.696 Waiting 2.100 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
1:55.796 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
1:57.095 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
1:58.393 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune unholy_strength
1:59.692 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune unholy_strength
2:00.990 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
2:02.287 Waiting 2.100 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune unholy_strength
2:04.387 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
2:05.686 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:06.985 Waiting 3.900 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune
2:10.885 remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune
2:12.396 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune
2:13.695 Waiting 0.700 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
2:14.395 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength
2:15.693 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune unholy_strength
2:16.991 Waiting 0.100 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
2:17.091 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
2:18.627 Waiting 3.100 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
2:21.727 howling_blast Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:23.026 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:24.323 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
2:25.619 Waiting 0.200 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
2:25.819 pillar_of_frost Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
2:26.000 Waiting 4.100 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:30.100 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:31.570 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
2:32.868 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
2:34.166 remorseless_winter Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:35.465 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
2:36.764 Waiting 3.500 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
2:40.264 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
2:41.563 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
2:42.861 howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
2:44.158 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
2:45.457 Waiting 3.400 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
2:48.857 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
2:50.157 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
2:51.454 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength
2:52.753 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune unholy_strength
2:54.051 Waiting 2.100 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune unholy_strength
2:56.151 remorseless_winter Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
2:57.450 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
2:58.749 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune unholy_strength
3:00.047 Waiting 4.800 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
3:04.847 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
3:06.146 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:07.443 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:08.740 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
3:10.037 howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
3:11.336 Waiting 0.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
3:12.036 empower_rune_weapon Fluffy_Pillow 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
3:12.222 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 6.0/6: 100% rune
3:13.521 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 5.0/6: 83% rune
3:14.820 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 5.0/6: 83% rune
3:16.120 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 3.0/6: 50% rune rime
3:17.419 pillar_of_frost Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune rime
3:17.419 howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
3:18.718 remorseless_winter Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune pillar_of_frost
3:20.016 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune pillar_of_frost
3:21.315 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:22.613 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:23.912 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:25.209 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
3:26.508 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:27.807 Waiting 0.300 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
3:28.107 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
3:29.406 Waiting 0.100 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
3:29.506 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
3:30.805 Waiting 1.300 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
3:32.105 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
3:33.403 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
3:34.701 howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength
3:35.999 Waiting 2.200 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
3:38.199 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune unholy_strength
3:39.496 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune rime, unholy_strength
3:40.796 glacial_advance Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune unholy_strength
3:42.094 remorseless_winter Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune unholy_strength
3:43.391 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune unholy_strength
3:44.690 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
3:45.990 Waiting 0.800 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
3:46.790 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune unholy_strength
3:48.089 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
3:49.388 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
3:50.686 Waiting 1.400 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
3:52.086 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
3:53.385 Waiting 0.200 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:53.585 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:55.037 Waiting 0.400 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
3:55.437 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
3:56.735 Waiting 1.300 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
3:58.035 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
3:59.333 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
4:00.633 Waiting 2.600 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
4:03.233 pillar_of_frost Fluffy_Pillow 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength
4:03.419 Waiting 0.600 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
4:04.019 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:05.317 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
4:06.616 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune pillar_of_frost
4:07.978 Waiting 2.100 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost
4:10.078 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
4:11.377 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost
4:12.675 howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
4:13.973 Waiting 1.300 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost
4:15.273 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost
4:16.572 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost
4:17.869 Waiting 3.400 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune pillar_of_frost
4:21.269 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost
4:22.567 Waiting 1.300 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
4:23.867 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
4:25.165 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
4:26.463 remorseless_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
4:27.762 Waiting 4.800 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
4:32.562 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune unholy_strength
4:33.861 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune unholy_strength
4:35.161 glacial_advance Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
4:36.458 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:37.758 Waiting 0.800 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:38.558 howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
4:39.856 Waiting 1.300 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
4:41.156 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
4:42.455 Waiting 3.800 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
4:46.255 remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
4:47.762 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
4:49.061 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength
4:50.358 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
4:51.657 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
4:52.952 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
4:54.251 pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune unholy_strength
4:54.251 Waiting 1.600 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
4:55.851 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
4:57.150 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
4:58.446 howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength
4:59.744 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
5:01.044 sindragosas_fury Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost
5:02.342 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost
5:03.640 Waiting 0.800 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune pillar_of_frost
5:04.440 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost
5:05.737 Waiting 1.300 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost
5:07.037 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost
5:08.336 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune pillar_of_frost
5:09.634 Waiting 3.400 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune pillar_of_frost
5:13.034 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost
5:14.332 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune
5:15.631 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune
5:16.929 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune rime
5:18.227 Waiting 3.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine
5:21.727 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:23.025 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
5:24.323 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:25.621 Waiting 2.200 sec 15.0/100: 15% runic_power | 1.0/6: 17% rune unholy_strength
5:27.821 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:29.119 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
5:30.418 Waiting 2.400 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
5:32.818 remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
5:34.333 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength
5:35.632 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune killing_machine, rime, unholy_strength
5:36.933 howling_blast Fluffy_Pillow 5.0/100: 5% runic_power | 0.0/6: 0% rune killing_machine, rime, unholy_strength
5:38.231 Waiting 0.700 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
5:38.931 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
5:40.229 Waiting 1.300 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
5:41.529 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength
5:42.827 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
5:44.125 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
5:44.251 Waiting 1.700 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:45.951 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
5:47.249 Waiting 2.900 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
5:50.149 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength
5:51.446 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:52.744 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
5:54.042 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
5:55.340 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
5:56.639 frostscythe Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
5:57.938 Waiting 0.900 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
5:58.838 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
6:00.136 Waiting 2.200 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:02.336 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength
6:03.635 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
6:04.934 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:06.234 Waiting 1.200 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
6:07.434 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune unholy_strength
6:08.732 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
6:10.032 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
6:11.331 Waiting 0.700 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
6:12.031 empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
6:12.222 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 6.0/6: 100% rune killing_machine, unholy_strength
6:13.520 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 5.0/6: 83% rune unholy_strength
6:14.820 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 5.0/6: 83% rune unholy_strength
6:16.119 obliterate Fluffy_Pillow 25.0/100: 25% runic_power | 3.0/6: 50% rune unholy_strength
6:17.417 howling_blast Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune rime, unholy_strength
6:18.716 remorseless_winter Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune unholy_strength
6:20.013 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune unholy_strength
6:21.313 glacial_advance Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune unholy_strength
6:22.612 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune unholy_strength
6:23.909 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 3.0/6: 50% rune unholy_strength
6:25.208 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune rime, unholy_strength
6:26.507 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune unholy_strength
6:27.806 Waiting 0.600 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:28.406 frostscythe Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:29.705 Waiting 0.100 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
6:29.805 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune unholy_strength
6:31.104 pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
6:31.104 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:32.402 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength
6:33.700 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
6:34.999 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
6:36.297 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength
6:37.597 Waiting 0.600 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
6:38.197 glacial_advance Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:39.494 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength
6:40.793 frostscythe Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength
6:42.091 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
6:43.390 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune pillar_of_frost
6:44.688 Waiting 4.700 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune pillar_of_frost
6:49.388 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune pillar_of_frost
6:50.686 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, rime
6:51.986 howling_blast Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune rime
6:53.285 glacial_advance Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune
6:54.584 Waiting 0.800 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength
6:55.384 frostscythe Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength
6:56.683 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
6:57.982 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune unholy_strength
6:59.279 Waiting 3.500 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune unholy_strength
7:02.779 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune unholy_strength
7:04.078 remorseless_winter Fluffy_Pillow 0.0/100: 0% runic_power | 1.0/6: 17% rune unholy_strength
7:05.376 Waiting 1.300 sec 10.0/100: 10% runic_power | 0.0/6: 0% rune unholy_strength
7:06.676 glacial_advance Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune unholy_strength
7:07.974 Waiting 2.100 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
7:10.074 frostscythe Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune killing_machine
7:11.374 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune
7:12.671 Waiting 2.600 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune
7:15.271 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 3.0/6: 50% rune
7:16.570 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune
7:17.867 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 2.0/6: 33% rune killing_machine
7:19.167 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune
7:20.466 glacial_advance Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune
7:21.765 pillar_of_frost Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune unholy_strength
7:21.765 Waiting 1.500 sec 20.0/100: 20% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
7:23.265 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
7:24.565 obliterate Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength
7:25.863 frost_strike Fluffy_Pillow 55.0/100: 55% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:27.161 frost_strike Fluffy_Pillow 30.0/100: 30% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:28.458 Waiting 1.500 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:29.958 remorseless_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength
7:31.256 Waiting 1.300 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength
7:32.556 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26175 24469 13073 (8512)
Agility 7857 7532 0
Stamina 30432 30432 18892
Intellect 4327 4002 0
Spirit 0 0 0
Health 1825920 1825920 0
Runic Power 100 100 0
Rune 6 6 0
Crit 28.47% 27.38% 7834
Haste 15.90% 15.90% 5168
Swing Speed 29.81% 29.81% 5168
Damage / Heal Versatility 1.74% 1.74% 696
Attack Power 26175 24469 0
Mastery 28.68% 28.68% 3891
Armor 4444 4444 4040
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 850.00
Local Head Crown of Fallen Kings
ilevel: 870, stats: { 580 Armor, +2344 Sta, +1563 StrInt, +1005 Crit, +401 Mastery }
Local Neck Nightmare Pendant
ilevel: 835, stats: { +952 Sta, +1042 Crit, +695 Haste }, enchant: { +75 Crit }
Local Shoulders Tremorguard Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +584 Mastery, +378 Crit }
Local Chest Horror Inscribed Chestguard
ilevel: 850, stats: { 683 Armor, +1945 Sta, +1297 StrInt, +932 Crit, +372 Haste }
Local Waist Nightsfall Girdle
ilevel: 835, stats: { 371 Armor, +846 StrInt, +1269 Sta, +602 Haste, +324 Mastery }
Local Legs Wracksoul Legplates
ilevel: 835, stats: { 578 Armor, +1128 StrInt, +1692 Sta, +855 Crit, +379 Haste }
Local Feet Curserunner Soulcrushers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +563 Haste, +398 Mastery }
Local Wrists Deathlord's Bracers
ilevel: 840, stats: { 292 Armor, +997 Sta, +665 Str, +444 Crit, +263 Mastery }, gems: { +150 Crit }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 855, stats: { 431 Armor, +1529 Sta, +1019 StrInt, +648 Haste, +349 Mastery }
Local Finger1 Band of the Wyrm Matron
ilevel: 850, stats: { +1094 Sta, +1154 Crit, +682 Vers }, enchant: { +150 Crit }
Local Finger2 Band of Fused Coral
ilevel: 840, stats: { +997 Sta, +1263 Haste, +505 Crit }, enchant: { +150 Crit }
Local Trinket1 Ironrune Charm
ilevel: 840, stats: { +1123 Str, +898 Mastery }
Local Trinket2 Ursoc's Rending Paw
ilevel: 850, stats: { +1233 Str }
Local Back Windwhipped Greatcloak
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +545 Haste, +218 Crit }, enchant: { +150 Str }
Local Main Hand Blades of the Fallen Prince
ilevel: 874, weapon: { 4121 - 7656, 2.6 }, stats: { +695 Str, +1043 Sta, +311 Crit, +299 Mastery }, enchant: rune_of_razorice, relics: { +39 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 874, weapon: { 4121 - 7656, 2.6 }, stats: { +695 Str, +1043 Sta, +311 Crit, +299 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Ethila"
origin="https://eu.api.battle.net/wow/character/hyjal/Ethila/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/179/115079091-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=jewelcrafting=766/mining=790
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!0002102
artifact=12:0:0:0:0:108:3:109:2:110:3:113:3:117:3:119:1:120:1:122:1:123:1:124:1:1090:3:1332:1
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/potion,name=old_war
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up
actions+=/obliteration
actions+=/breath_of_sindragosa,if=runic_power>=50
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=shatter,if=talent.shattering_strikes.enabled
actions+=/call_action_list,name=icytalons,if=talent.icy_talons.enabled
actions+=/call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)

actions.bos=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/call_action_list,name=core
actions.bos+=/horn_of_winter
actions.bos+=/empower_rune_weapon,if=runic_power<=70
actions.bos+=/hungering_rune_weapon
actions.bos+=/howling_blast,if=buff.rime.react

actions.core=remorseless_winter,if=artifact.frozen_soul.enabled
actions.core+=/glacial_advance
actions.core+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.core+=/remorseless_winter,if=spell_targets.remorseless_winter>=2
actions.core+=/frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
actions.core+=/obliterate,if=buff.killing_machine.react
actions.core+=/obliterate
actions.core+=/remorseless_winter
actions.core+=/frostscythe,if=talent.frozen_pulse.enabled
actions.core+=/howling_blast,if=talent.frozen_pulse.enabled

actions.generic=howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/howling_blast,if=buff.rime.react
actions.generic+=/frost_strike,if=runic_power>=80
actions.generic+=/call_action_list,name=core
actions.generic+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.icytalons=frost_strike,if=buff.icy_talons.remains<1.5
actions.icytalons+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.icytalons+=/howling_blast,if=buff.rime.react
actions.icytalons+=/frost_strike,if=runic_power>=80|buff.icy_talons.stack<3
actions.icytalons+=/call_action_list,name=core
actions.icytalons+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.shatter=frost_strike,if=debuff.razorice.stack=5
actions.shatter+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.shatter+=/howling_blast,if=buff.rime.react
actions.shatter+=/frost_strike,if=runic_power>=80
actions.shatter+=/call_action_list,name=core
actions.shatter+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

head=crown_of_fallen_kings,id=133629,bonus_id=1726/1522/3337
neck=nightmare_pendant,id=121284,bonus_id=3432/1497/1674,enchant=75crit
shoulders=tremorguard_pauldrons,id=134517,bonus_id=1726/1497/3337
back=windwhipped_greatcloak,id=141541,bonus_id=1472,enchant=150str
chest=horror_inscribed_chestguard,id=138216,bonus_id=1807/1472
wrists=deathlords_bracers,id=139680,bonus_id=3385/3384,gems=150crit
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1807/1477/3336
waist=nightsfall_girdle,id=139057,bonus_id=3432/1497/1674
legs=wracksoul_legplates,id=121280,bonus_id=3432/1497/1674
feet=curserunner_soulcrushers,id=134504,bonus_id=1727/1497/3336
finger1=band_of_the_wyrm_matron,id=134524,bonus_id=1727/1502/3336,enchant=150crit
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1492/1813,enchant=150crit
trinket1=ironrune_charm,id=134190,bonus_id=3432/605/1502/3336
trinket2=ursocs_rending_paw,id=139328,bonus_id=1807/1472
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=133683/138226/137380/0,relic_id=1726:1487:3336/1807:1472/1726:1497:3337/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=849.88
# gear_strength=13073
# gear_stamina=18892
# gear_crit_rating=7680
# gear_haste_rating=5067
# gear_mastery_rating=3815
# gear_versatility_rating=682
# gear_armor=4040

Wadzak

Wadzak : 202867 dps

  • Race: Human
  • Class: Deathknight
  • Spec: Frost
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
202867.3 202867.3 116.1 / 0.057% 23451.2 / 11.6% 32352.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.3 6.3 Runic Power 22.45% 39.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Wadzak/advanced
Talents
  • 15: Shattering Strikes (Frost Death Knight)
  • 30: Freezing Fog (Frost Death Knight)
  • 45: Icecap (Frost Death Knight)
  • 60: Winter is Coming (Frost Death Knight)
  • 75: Permafrost (Frost Death Knight)
  • 90: Runic Attenuation (Frost Death Knight)
  • 100: Obliteration (Frost Death Knight)
  • Talent Calculator
Artifact
Professions
  • alchemy: 200
  • herbalism: 99

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Wadzak 202867
auto_attack_mh 11228 5.5% 229.5 1.97sec 22032 11221 Direct 229.5 20651 41312 22033 25.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.46 229.46 0.00 0.00 1.9636 0.0000 5055601.39 7432212.93 31.98 11220.66 11220.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.11 55.40% 20651.47 17255 23254 20651.83 20010 21333 2625092 3859135 31.98
crit 58.83 25.64% 41311.98 34511 46508 41313.65 39372 43087 2430509 3573078 31.98
miss 43.51 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5623 2.8% 229.5 1.97sec 11035 5620 Direct 229.5 10355 20709 11035 25.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.46 229.46 0.00 0.00 1.9636 0.0000 2532213.53 3722593.75 31.98 5620.12 5620.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.98 55.34% 10355.39 8628 11627 10355.82 10055 10692 1314968 1933128 31.98
crit 58.78 25.62% 20709.27 17255 23254 20710.01 19634 21686 1217245 1789466 31.98
miss 43.70 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Crystalline Swords 13060 6.4% 77.7 11.52sec 75679 0 Direct 77.7 60200 120435 75679 25.7% 0.0%  

Stats details: crystalline_swords

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.71 77.71 0.00 0.00 0.0000 0.0000 5881225.67 5881225.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.74 74.30% 60200.43 44328 84332 60205.01 55432 65612 3476062 3476062 0.00
crit 19.97 25.70% 120434.52 88894 168664 120449.76 104508 140533 2405164 2405164 0.00
 
 

Action details: crystalline_swords

Static Values
  • id:205165
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.3000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205165
  • name:Crystalline Swords
  • school:frost
  • tooltip:
  • description:{$@spelldesc189186=Your melee attacks have a chance to create icy copies of |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r, which will then stab and pierce your foes.}
 
Frost Fever 14048 6.9% 44.5 10.31sec 142253 0 Periodic 149.9 33592 67177 42216 25.7% 0.0% 99.3%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.49 0.00 149.93 149.93 0.0000 2.9854 6329242.48 6329242.48 0.00 14140.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.4 74.32% 33592.13 11 48315 33595.15 31778 35439 3743127 3743127 0.00
crit 38.5 25.68% 67176.83 35 96630 67185.73 59639 75367 2586116 2586116 0.00
 
 

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frost Strike 0 (69223) 0.0% (34.1%) 112.9 3.98sec 276162 216814

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.86 0.00 0.00 0.00 1.2737 0.0000 0.00 0.00 0.00 216813.96 216813.96
 
 

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.obliteration.up&!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your weapons with icy power, and quickly strike the enemy with both weapons, dealing a total of ${$222026sw1+$66196sw1} Frost damage.
 
    Frost Strike (_mh) 45297 22.3% 112.9 3.98sec 180710 0 Direct 112.9 143723 287406 180711 25.7% 0.0%  

Stats details: frost_strike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.86 112.86 0.00 0.00 0.0000 0.0000 20395472.45 20395472.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.81 74.26% 143723.27 93820 233338 143752.94 130351 156053 12045404 12045404 0.00
crit 29.05 25.74% 287406.01 188020 466676 287402.80 243411 334051 8350068 8350068 0.00
 
 

Action details: frost_strike_mh

Static Values
  • id:222026
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222026
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
    Frost Strike Off-Hand 23926 11.8% 112.9 3.98sec 95452 0 Direct 112.9 75893 151792 95450 25.8% 0.0%  

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.86 112.86 0.00 0.00 0.0000 0.0000 10773051.59 10773051.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.78 74.23% 75893.15 47850 116673 75903.82 70983 81961 6358127 6358127 0.00
crit 29.09 25.77% 151791.79 95894 233345 151816.58 129803 174658 4414925 4414925 0.00
 
 

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:108.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:Instantly strike the enemy with your off-hand weapon, causing $sw2 Frost damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.80
 
Frozen Soul 2378 1.2% 21.7 21.14sec 49368 0 Direct 21.7 39232 78430 49368 25.9% 0.0%  

Stats details: frozen_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.69 21.69 0.00 0.00 0.0000 0.0000 1070823.04 1070823.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.08 74.14% 39231.54 29634 56225 39235.91 34745 44033 630896 630896 0.00
crit 5.61 25.86% 78430.21 59268 112450 78182.69 0 110406 439927 439927 0.00
 
 

Action details: frozen_soul

Static Values
  • id:204959
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204959
  • name:Frozen Soul
  • school:frost
  • tooltip:
  • description:{$@spelldesc189184=When Remorseless Winter ends, |cFFFFCC99Icebringer|r and |cFFFFCC99Frostreaper|r release a burst of {$204959s1=1} Frost damage, increased by {$s2=100}% for each additional enemy you hit during Remorseless Winter.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.400000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Howling Blast 20958 10.3% 44.5 10.31sec 212007 166575 Direct 44.5 168460 337200 212011 25.8% 0.0%  

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.49 44.49 0.00 0.00 1.2728 0.0000 9432810.91 9432810.91 0.00 166575.03 166575.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.01 74.19% 168459.89 33104 251239 168260.23 136751 190442 5560741 5560741 0.00
crit 11.48 25.81% 337200.21 66208 502478 336781.92 0 423701 3872070 3872070 0.00
 
 

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$s2=0} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and ${($m1/100)*$m2} Frost damage to all other enemies within 10 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals ${8*{$s1=0}} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight ${$195617m1/10} Runic Power each time it deals damage.}
 
Obliterate 0 (44379) 0.0% (21.9%) 94.5 4.77sec 211397 166635

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.49 0.00 0.00 0.00 1.2686 0.0000 0.00 0.00 0.00 166634.53 166634.53
 
 

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.
 
    Obliterate (_mh) 29584 14.6% 94.5 4.77sec 140924 0 Direct 94.5 74330 183498 140924 61.0% 0.0%  

Stats details: obliterate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.49 94.49 0.00 0.00 0.0000 0.0000 13315441.02 19574959.57 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.85 39.00% 74329.79 63681 82783 74337.36 70237 78459 2738887 4026424 31.98
crit 57.64 61.00% 183497.68 158251 205302 183501.67 174931 190907 10576554 15548536 31.98
 
 

Action details: obliterate_mh

Static Values
  • id:222024
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
    Obliterate Off-Hand 14795 7.3% 94.5 4.77sec 70472 0 Direct 94.5 37171 91745 70472 61.0% 0.0%  

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.49 94.49 0.00 0.00 0.0000 0.0000 6658706.40 9788929.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.83 38.98% 37171.17 31842 41393 37174.79 34584 39057 1368991 2012547 31.98
crit 57.66 61.02% 91744.52 79129 102654 91747.42 87755 95758 5289715 7776382 31.98
 
 

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack with both weapons that deals a total of ${$222024sw1+$66198sw1} Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.80
 
Potion of the Old War 8031 3.9% 23.4 3.72sec 151966 0 Direct 23.4 120803 241607 151965 25.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 0.00 0.00 0.0000 0.0000 3560270.80 5233935.32 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.38 74.20% 120803.25 120803 120803 120803.25 120803 120803 2100121 3087377 31.98
crit 6.04 25.80% 241606.50 241607 241607 241413.20 0 241607 1460150 2146559 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Razorice 5506 2.7% 393.3 1.15sec 6304 0 Direct 393.3 5015 10029 6304 25.7% 0.0%  

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 393.27 393.27 0.00 0.00 0.0000 0.0000 2479123.26 2479123.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 292.19 74.30% 5014.87 3952 6643 5015.28 4844 5254 1465280 1465280 0.00
crit 101.09 25.70% 10029.46 7904 13285 10030.63 9498 10573 1013843 1013843 0.00
 
 

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes {$50401s1=0}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=2}%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.10
 
Remorseless Winter 8435 4.2% 21.7 21.21sec 175188 136217 Periodic 171.8 17594 35203 22114 25.7% 0.0% 38.1%

Stats details: remorseless_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.69 0.00 171.84 171.84 1.2861 1.0000 3799918.36 3799918.36 0.00 19025.18 136217.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.7 74.33% 17594.24 13192 25300 17594.87 16483 18877 2247351 2247351 0.00
crit 44.1 25.67% 35203.37 26384 50599 35204.83 31855 39460 1552568 1552568 0.00
 
 

Action details: remorseless_winter

Static Values
  • id:196770
  • school:frost
  • resource:rune
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.frozen_soul.enabled
Spelldata
  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies each second.
  • description:Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: remorseless_winter_damage

Static Values
  • id:196771
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies, dealing ${9*{$196771s1=0}} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=50}%.}
 
Simple Action Stats Execute Interval
Wadzak
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
Empower Rune Weapon 2.8 183.37sec

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:runic_power
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:runic_power<=70
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:
  • description:Empower your rune weapon, immediately activating all your runes and generating {$s3=25} Runic Power.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:false
  • if_expr:
 
Obliteration 5.5 90.30sec

Stats details: obliteration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.51 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: obliteration

Static Values
  • id:207256
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:207256
  • name:Obliteration
  • school:physical
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
 
Pillar of Frost 9.9 48.58sec

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Unholy Strength 30.1 14.98sec

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 30.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Wadzak
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.75% 0.0(0.0) 1.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 370.7 0.0sec 1.2sec 99.99% 99.99% 351.7(351.7) 0.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.07%
  • chaotic_energy_2:0.19%
  • chaotic_energy_3:0.17%
  • chaotic_energy_4:0.25%
  • chaotic_energy_5:0.19%
  • chaotic_energy_6:0.23%
  • chaotic_energy_7:0.20%
  • chaotic_energy_8:0.22%
  • chaotic_energy_9:0.21%
  • chaotic_energy_10:0.22%
  • chaotic_energy_11:0.21%
  • chaotic_energy_12:0.22%
  • chaotic_energy_13:0.22%
  • chaotic_energy_14:0.22%
  • chaotic_energy_15:0.22%
  • chaotic_energy_16:0.22%
  • chaotic_energy_17:0.22%
  • chaotic_energy_18:0.22%
  • chaotic_energy_19:0.22%
  • chaotic_energy_20:96.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Dirge of Angerboda 4.0 0.2 86.2sec 79.8sec 7.30% 7.36% 0.2(0.2) 3.9

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4130.25

Stack Uptimes

  • dirge_of_angerboda_1:7.30%

Trigger Attempt Success

  • trigger_pct:98.81%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Howl of Ingvar 4.0 0.3 85.5sec 79.0sec 7.35% 7.42% 0.3(0.3) 4.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4130.25

Stack Uptimes

  • howl_of_ingvar_1:7.35%

Trigger Attempt Success

  • trigger_pct:98.60%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Machine 45.3 7.9 10.0sec 8.5sec 28.54% 32.14% 7.9(7.9) 0.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00

Stack Uptimes

  • killing_machine_1:28.54%

Trigger Attempt Success

  • trigger_pct:45.46%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Obliteration 5.5 0.0 90.3sec 90.3sec 9.72% 9.92% 0.0(0.0) 5.4

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_obliteration
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • obliteration_1:9.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207256
  • name:Obliteration
  • tooltip:Obliterate cost reduced. Triggering Killing Machine from Frost Strike hits.
  • description:For the next {$d=8 seconds}, every Frost Strike hit triggers Killing Machine, and Obliterate costs {$s1=1} less Rune.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:100.00%
Pillar of Frost 9.9 0.0 48.0sec 48.5sec 42.94% 42.62% 0.0(0.0) 9.5

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • pillar_of_frost_1:42.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$s1=20}%.
  • description:The power of Frost increases your Strength by {$s1=20}%, and grants immunity to external movement effects such as knockbacks. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 58.4sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rime 42.4 0.1 10.5sec 10.5sec 16.68% 48.56% 0.1(0.1) 0.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00

Stack Uptimes

  • rime_1:16.68%

Trigger Attempt Success

  • trigger_pct:45.00%

Spelldata details

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=300}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=300}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Strength 12.7 17.4 36.1sec 15.0sec 67.11% 66.79% 17.4(17.4) 12.1

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • unholy_strength_1:67.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 4.0 0.2 86.7sec 80.2sec 7.24% 7.30% 0.2(0.2) 3.9

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4130.25

Stack Uptimes

  • wail_of_svala_1:7.24%

Trigger Attempt Success

  • trigger_pct:98.87%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=83941)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.3641.579 / 1.3233.26110.565
Total Seconds per Iteration (n=10007)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.5538.46813.241 / 12.88819.28031.443

Resources

Resource Usage Type Count Total Average RPE APR
Wadzak
frost_strike Runic Power 112.9 2821.5 25.0 25.0 11046.6
howling_blast Rune 44.5 2.2 0.1 0.1 4223640.4
obliterate Rune 94.5 174.9 1.9 1.9 114222.1
remorseless_winter Rune 21.7 21.7 1.0 1.0 175188.0
Resource Gains Type Count Total Average Overflow
howling_blast Runic Power 2.23 22.33 (0.78%) 10.00 0.00 0.00%
remorseless_winter Runic Power 21.69 216.91 (7.62%) 10.00 0.00 0.00%
obliterate Runic Power 94.48 1889.70 (66.39%) 20.00 0.00 0.00%
Frost Fever Runic Power 27.17 135.76 (4.77%) 5.00 0.08 0.06%
Rune Regeneration Rune 150.44 150.44 (77.69%) 1.00 0.00 0.00%
Runic Empowerment Rune 28.22 28.22 (14.57%) 1.00 0.00 0.00%
Empower Rune Weapon Rune 14.99 14.99 (7.74%) 1.00 0.00 0.00%
Runic Attenuation Runic Power 458.92 458.76 (16.12%) 1.00 0.17 0.04%
Over-Powered Runic Power 9.47 122.84 (4.32%) 12.97 0.33 0.27%
Resource RPS-Gain RPS-Loss
Runic Power 6.32 6.26
Rune 0.43 0.44
Combat End Resource Mean Min Max
Runic Power 24.71 0.00 90.00
Rune 0.90 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.0%

Procs

Count Interval
Killing Machine: Obliterate 44.9 10.0sec
Rune ready 193.7 3.1sec

Statistics & Data Analysis

Fight Length
Sample Data Wadzak Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Wadzak Damage Per Second
Count 9999
Mean 202867.28
Minimum 184153.55
Maximum 227476.53
Spread ( max - min ) 43322.98
Range [ ( max - min ) / 2 * 100% ] 10.68%
Standard Deviation 5922.8391
5th Percentile 193387.75
95th Percentile 212974.76
( 95th Percentile - 5th Percentile ) 19587.01
Mean Distribution
Standard Deviation 59.2314
95.00% Confidence Intervall ( 202751.19 - 202983.37 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3274
0.1 Scale Factor Error with Delta=300 299463
0.05 Scale Factor Error with Delta=300 1197853
0.01 Scale Factor Error with Delta=300 29946325
Priority Target DPS
Sample Data Wadzak Priority Target Damage Per Second
Count 9999
Mean 202867.28
Minimum 184153.55
Maximum 227476.53
Spread ( max - min ) 43322.98
Range [ ( max - min ) / 2 * 100% ] 10.68%
Standard Deviation 5922.8391
5th Percentile 193387.75
95th Percentile 212974.76
( 95th Percentile - 5th Percentile ) 19587.01
Mean Distribution
Standard Deviation 59.2314
95.00% Confidence Intervall ( 202751.19 - 202983.37 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3274
0.1 Scale Factor Error with Delta=300 299463
0.05 Scale Factor Error with Delta=300 1197853
0.01 Scale Factor Error with Delta=300 29946325
DPS(e)
Sample Data Wadzak Damage Per Second (Effective)
Count 9999
Mean 202867.28
Minimum 184153.55
Maximum 227476.53
Spread ( max - min ) 43322.98
Range [ ( max - min ) / 2 * 100% ] 10.68%
Damage
Sample Data Wadzak Damage
Count 9999
Mean 91283900.90
Minimum 67230538.99
Maximum 117559957.86
Spread ( max - min ) 50329418.88
Range [ ( max - min ) / 2 * 100% ] 27.57%
DTPS
Sample Data Wadzak Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Wadzak Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Wadzak Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Wadzak Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Wadzak Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Wadzak Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data WadzakTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Wadzak Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=countless_armies
1 0.00 food,name=the_hungry_magister
2 0.00 augmentation,name=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 9.88 pillar_of_frost
0.00 arcane_torrent,if=runic_power.deficit>20
0.00 blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
0.00 berserking,if=buff.pillar_of_frost.up
7 1.00 potion,name=old_war
0.00 sindragosas_fury,if=buff.pillar_of_frost.up
8 5.51 obliteration
0.00 breath_of_sindragosa,if=runic_power>=50
9 0.00 run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
A 0.00 call_action_list,name=shatter,if=talent.shattering_strikes.enabled
B 0.00 call_action_list,name=icytalons,if=talent.icy_talons.enabled
C 0.00 call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)
actions.core
# count action,conditions
E 21.69 remorseless_winter,if=artifact.frozen_soul.enabled
0.00 glacial_advance
F 6.73 frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
0.00 remorseless_winter,if=spell_targets.remorseless_winter>=2
0.00 frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
G 41.17 obliterate,if=buff.killing_machine.react
H 53.32 obliterate
0.00 remorseless_winter
0.00 frostscythe,if=talent.frozen_pulse.enabled
0.00 howling_blast,if=talent.frozen_pulse.enabled
actions.shatter
# count action,conditions
K 46.61 frost_strike,if=debuff.razorice.stack=5
L 2.49 howling_blast,target_if=!dot.frost_fever.ticking
M 42.00 howling_blast,if=buff.rime.react
N 1.24 frost_strike,if=runic_power>=80
O 0.00 call_action_list,name=core
0.00 horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 horn_of_winter,if=!talent.breath_of_sindragosa.enabled
0.00 frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
P 58.28 frost_strike,if=!talent.breath_of_sindragosa.enabled
0.00 empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
0.00 hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
Q 2.81 empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
0.00 hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

Sample Sequence

0124568LEGFGMFGKMHHKHMPPGPQHKEHMPPGHKMHPKHPHMKHEP6GKMHPK7HPEKGMPHPHMPEPGKM8GMFGK6GMPHKEPGPGPHGKMPEHKMPHKG6MEPHPHKMPGMGKMEGPHKPP8GKGHMGKPEG6KMPHPGPQGKMHHMKEPGMHKMPGPHPEKHMP6GMPGKEPHPGMPHKMG8FGKEGFKGMPHKM6GMPEPHKMHPKGPEGKMHPHKHPE6KGMPHMPHKMHMH8FPEGFGKGMPHKMEHKM6HPKHPQHHKMGMPEHMPKPGPHKHMPEHKMPH6MKHPEGK8MH

Sample Sequence Table

time name target resources buffs
Pre flask Wadzak 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre food Wadzak 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre augmentation Wadzak 0.0/100: 0% runic_power | 6.0/6: 100% rune
Pre potion Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% runic_power | 6.0/6: 100% rune potion_of_the_old_war
0:00.000 pillar_of_frost Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune unholy_strength, chaotic_energy(2), potion_of_the_old_war
0:00.000 obliteration Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune pillar_of_frost, unholy_strength, chaotic_energy(2), potion_of_the_old_war
0:00.000 howling_blast Fluffy_Pillow 2.0/100: 2% runic_power | 6.0/6: 100% rune obliteration, pillar_of_frost, unholy_strength, chaotic_energy(2), potion_of_the_old_war
0:01.249 remorseless_winter Fluffy_Pillow 14.0/100: 14% runic_power | 5.0/6: 83% rune bloodlust, killing_machine, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(4), potion_of_the_old_war
0:02.268 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(4), potion_of_the_old_war
0:03.288 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 3.0/6: 50% rune bloodlust, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(6), potion_of_the_old_war
0:04.307 obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 3.0/6: 50% rune bloodlust, killing_machine, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(8), potion_of_the_old_war
0:05.326 howling_blast Fluffy_Pillow 43.0/100: 43% runic_power | 2.0/6: 33% rune bloodlust, obliteration, pillar_of_frost, rime, unholy_strength, chaotic_energy(8), potion_of_the_old_war
0:06.344 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 2.0/6: 33% rune bloodlust, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(10), potion_of_the_old_war
0:07.362 obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 3.0/6: 50% rune bloodlust, killing_machine, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(12), potion_of_the_old_war
0:08.382 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, rime, unholy_strength, chaotic_energy(12), potion_of_the_old_war
0:09.402 howling_blast Fluffy_Pillow 19.0/100: 19% runic_power | 5.0/6: 83% rune bloodlust, pillar_of_frost, rime, unholy_strength, chaotic_energy(13), potion_of_the_old_war
0:10.421 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 5.0/6: 83% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(13), potion_of_the_old_war
0:11.441 obliterate Fluffy_Pillow 54.0/100: 54% runic_power | 3.0/6: 50% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(15), potion_of_the_old_war
0:12.461 frost_strike Fluffy_Pillow 76.0/100: 76% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(16), potion_of_the_old_war
0:13.482 obliterate Fluffy_Pillow 51.0/100: 51% runic_power | 2.0/6: 33% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(16), potion_of_the_old_war
0:14.501 howling_blast Fluffy_Pillow 73.0/100: 73% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, rime, unholy_strength, chaotic_energy(18), potion_of_the_old_war
0:15.521 frost_strike Fluffy_Pillow 75.0/100: 75% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:16.540 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:17.560 obliterate Fluffy_Pillow 27.0/100: 27% runic_power | 3.0/6: 50% rune bloodlust, killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:18.579 frost_strike Fluffy_Pillow 49.0/100: 49% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:19.598 empower_rune_weapon Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:19.598 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 6.0/6: 100% rune bloodlust, pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:20.620 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 4.0/6: 67% rune bloodlust, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:21.640 remorseless_winter Fluffy_Pillow 23.0/100: 23% runic_power | 4.0/6: 67% rune bloodlust, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:22.660 obliterate Fluffy_Pillow 33.0/100: 33% runic_power | 3.0/6: 50% rune bloodlust, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:23.681 howling_blast Fluffy_Pillow 55.0/100: 55% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, rime, unholy_strength, chaotic_energy(20)
0:24.700 frost_strike Fluffy_Pillow 57.0/100: 57% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength, chaotic_energy(20)
0:25.718 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune bloodlust, killing_machine, unholy_strength, chaotic_energy(20)
0:26.737 obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 4.0/6: 67% rune bloodlust, killing_machine, unholy_strength, chaotic_energy(20)
0:27.757 obliterate Fluffy_Pillow 31.0/100: 31% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, chaotic_energy(20)
0:28.776 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune bloodlust, rime, unholy_strength, chaotic_energy(20)
0:29.797 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune bloodlust, rime, unholy_strength, chaotic_energy(20)
0:30.816 obliterate Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, chaotic_energy(20)
0:31.836 frost_strike Fluffy_Pillow 50.0/100: 50% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, chaotic_energy(20)
0:32.855 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, chaotic_energy(20)
0:33.876 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, chaotic_energy(20)
0:34.898 Waiting 0.700 sec 24.0/100: 24% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, chaotic_energy(20)
0:35.598 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune bloodlust, unholy_strength, chaotic_energy(20)
0:36.619 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, chaotic_energy(20)
0:37.641 howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 0.0/6: 0% rune bloodlust, rime, unholy_strength, chaotic_energy(20)
0:38.660 Waiting 0.100 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, chaotic_energy(20)
0:38.760 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:39.779 Waiting 0.500 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune bloodlust, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:40.279 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune bloodlust, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:41.387 Waiting 0.900 sec 22.0/100: 22% runic_power | 0.0/6: 0% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:42.287 remorseless_winter Fluffy_Pillow 24.0/100: 24% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:43.611 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:44.933 pillar_of_frost Fluffy_Pillow 11.0/100: 11% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:44.933 Waiting 4.000 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
0:48.933 obliterate Fluffy_Pillow 15.0/100: 15% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
0:50.255 frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
0:51.577 howling_blast Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
0:52.899 obliterate Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
0:54.222 frost_strike Fluffy_Pillow 47.0/100: 47% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
0:55.544 Waiting 0.900 sec 24.0/100: 24% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
0:56.444 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
0:57.769 potion Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
0:58.000 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20), potion_of_the_old_war
0:59.323 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune pillar_of_frost, chaotic_energy(20), potion_of_the_old_war
1:00.646 Waiting 1.400 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, chaotic_energy(20), potion_of_the_old_war
1:02.046 remorseless_winter Fluffy_Pillow 23.0/100: 23% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, chaotic_energy(20), potion_of_the_old_war
1:03.609 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, chaotic_energy(20), potion_of_the_old_war
1:04.932 Waiting 1.600 sec 12.0/100: 12% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, chaotic_energy(20), potion_of_the_old_war
1:06.532 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, chaotic_energy(20), potion_of_the_old_war
1:07.855 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune rime, chaotic_energy(20), potion_of_the_old_war
1:09.179 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune chaotic_energy(20), potion_of_the_old_war
1:10.502 Waiting 4.300 sec 11.0/100: 11% runic_power | 1.0/6: 17% rune chaotic_energy(20), potion_of_the_old_war
1:14.802 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune chaotic_energy(20), potion_of_the_old_war
1:16.129 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune chaotic_energy(20), potion_of_the_old_war
1:17.454 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20), potion_of_the_old_war
1:18.777 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20), potion_of_the_old_war
1:20.099 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20), potion_of_the_old_war
1:21.424 Waiting 2.200 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, chaotic_energy(20), potion_of_the_old_war
1:23.624 remorseless_winter Fluffy_Pillow 15.0/100: 15% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
1:24.946 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
1:26.268 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
1:27.591 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
1:28.915 howling_blast Fluffy_Pillow 4.0/100: 4% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
1:30.240 obliteration Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
1:30.240 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength, chaotic_energy(20)
1:31.565 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune obliteration, rime, chaotic_energy(20)
1:32.888 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune obliteration, chaotic_energy(20)
1:34.210 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune killing_machine, obliteration, chaotic_energy(20)
1:35.533 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune obliteration, unholy_strength, chaotic_energy(20)
1:36.855 pillar_of_frost Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength, chaotic_energy(20)
1:36.855 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune killing_machine, obliteration, pillar_of_frost, unholy_strength, chaotic_energy(20)
1:38.179 howling_blast Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune obliteration, pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
1:39.502 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:40.825 Waiting 0.400 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:41.225 obliterate Fluffy_Pillow 14.0/100: 14% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:42.549 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:43.873 remorseless_winter Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:45.196 Waiting 0.300 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:45.496 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:46.819 Waiting 3.200 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
1:50.019 obliterate Fluffy_Pillow 4.0/100: 4% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
1:51.342 Waiting 0.200 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
1:51.542 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, chaotic_energy(20)
1:52.863 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, chaotic_energy(20)
1:54.188 Waiting 1.500 sec 23.0/100: 23% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
1:55.688 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
1:57.013 Waiting 1.800 sec 0.0/100: 0% runic_power | 1.0/6: 17% rune chaotic_energy(20)
1:58.813 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune chaotic_energy(20)
2:00.136 Waiting 1.300 sec 24.0/100: 24% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
2:01.436 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
2:02.760 frost_strike Fluffy_Pillow 46.0/100: 46% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
2:04.084 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
2:05.407 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
2:06.730 Waiting 0.900 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
2:07.630 remorseless_winter Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
2:08.953 Waiting 1.300 sec 17.0/100: 17% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
2:10.253 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
2:11.577 frost_strike Fluffy_Pillow 44.0/100: 44% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
2:12.901 howling_blast Fluffy_Pillow 21.0/100: 21% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
2:14.224 Waiting 0.800 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:15.024 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:16.348 Waiting 0.500 sec 5.0/100: 5% runic_power | 0.0/6: 0% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:16.848 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 2.0/6: 33% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:18.170 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 0.0/6: 0% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:19.493 Waiting 5.700 sec 2.0/100: 2% runic_power | 1.0/6: 17% rune unholy_strength, howl_of_ingvar, chaotic_energy(20)
2:25.193 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
2:26.517 pillar_of_frost Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
2:26.517 howling_blast Fluffy_Pillow 30.0/100: 30% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
2:27.840 remorseless_winter Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:29.164 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:30.488 Waiting 3.500 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:33.988 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:35.313 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:36.635 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
2:37.959 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, chaotic_energy(20)
2:39.283 howling_blast Fluffy_Pillow 17.0/100: 17% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, chaotic_energy(20)
2:40.607 Waiting 2.000 sec 19.0/100: 19% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
2:42.607 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
2:43.930 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 4.0/6: 67% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
2:45.253 howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
2:46.576 obliterate Fluffy_Pillow 36.0/100: 36% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
2:47.900 frost_strike Fluffy_Pillow 58.0/100: 58% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
2:49.224 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
2:50.548 remorseless_winter Fluffy_Pillow 35.0/100: 35% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
2:51.871 obliterate Fluffy_Pillow 52.0/100: 52% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
2:53.193 frost_strike Fluffy_Pillow 74.0/100: 74% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
2:54.516 obliterate Fluffy_Pillow 54.0/100: 54% runic_power | 2.0/6: 33% rune chaotic_energy(20)
2:55.839 frost_strike Fluffy_Pillow 76.0/100: 76% runic_power | 0.0/6: 0% rune chaotic_energy(20)
2:57.163 frost_strike Fluffy_Pillow 53.0/100: 53% runic_power | 0.0/6: 0% rune killing_machine, chaotic_energy(20)
2:58.486 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune killing_machine, chaotic_energy(20)
2:59.809 Waiting 0.200 sec 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:00.009 obliteration Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:00.240 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 1.0/6: 17% rune killing_machine, obliteration, chaotic_energy(20)
3:01.563 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 2.0/6: 33% rune obliteration, chaotic_energy(20)
3:02.887 obliterate Fluffy_Pillow 2.0/100: 2% runic_power | 2.0/6: 33% rune killing_machine, obliteration, chaotic_energy(20)
3:04.210 obliterate Fluffy_Pillow 24.0/100: 24% runic_power | 2.0/6: 33% rune obliteration, chaotic_energy(20)
3:05.533 howling_blast Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune killing_machine, obliteration, rime, chaotic_energy(20)
3:06.856 obliterate Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune killing_machine, obliteration, chaotic_energy(20)
3:08.179 frost_strike Fluffy_Pillow 68.0/100: 68% runic_power | 0.0/6: 0% rune obliteration, chaotic_energy(20)
3:09.502 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:10.827 remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune killing_machine, chaotic_energy(20)
3:12.151 obliterate Fluffy_Pillow 37.0/100: 37% runic_power | 2.0/6: 33% rune killing_machine, chaotic_energy(20)
3:13.474 pillar_of_frost Fluffy_Pillow 59.0/100: 59% runic_power | 0.0/6: 0% rune rime, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:13.474 frost_strike Fluffy_Pillow 59.0/100: 59% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:14.798 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:16.122 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:17.445 Waiting 1.700 sec 13.0/100: 13% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:19.145 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:20.469 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:21.792 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:23.115 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
3:24.438 empower_rune_weapon Fluffy_Pillow 9.0/100: 9% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
3:24.438 obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 6.0/6: 100% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
3:25.761 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 4.0/6: 67% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
3:27.084 howling_blast Fluffy_Pillow 6.0/100: 6% runic_power | 5.0/6: 83% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
3:28.408 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 5.0/6: 83% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
3:29.732 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 3.0/6: 50% rune pillar_of_frost, chaotic_energy(20)
3:31.057 howling_blast Fluffy_Pillow 50.0/100: 50% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, chaotic_energy(20)
3:32.380 frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, chaotic_energy(20)
3:33.704 remorseless_winter Fluffy_Pillow 29.0/100: 29% runic_power | 2.0/6: 33% rune killing_machine, chaotic_energy(20)
3:35.025 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:36.348 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 2.0/6: 33% rune killing_machine, chaotic_energy(20)
3:37.671 howling_blast Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune rime, chaotic_energy(20)
3:38.994 obliterate Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune chaotic_energy(20)
3:40.318 frost_strike Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune rime, chaotic_energy(20)
3:41.642 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune rime, chaotic_energy(20)
3:42.964 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:44.289 Waiting 1.800 sec 14.0/100: 14% runic_power | 1.0/6: 17% rune killing_machine, chaotic_energy(20)
3:46.089 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 3.0/6: 50% rune killing_machine, chaotic_energy(20)
3:47.414 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune chaotic_energy(20)
3:48.736 Waiting 2.100 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune chaotic_energy(20)
3:50.836 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune wail_of_svala, chaotic_energy(20)
3:52.025 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 0.0/6: 0% rune wail_of_svala, chaotic_energy(20)
3:53.213 Waiting 1.100 sec 17.0/100: 17% runic_power | 0.0/6: 0% rune unholy_strength, wail_of_svala, chaotic_energy(20)
3:54.313 remorseless_winter Fluffy_Pillow 19.0/100: 19% runic_power | 2.0/6: 33% rune unholy_strength, wail_of_svala, chaotic_energy(20)
3:55.500 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 1.0/6: 17% rune unholy_strength, wail_of_svala, chaotic_energy(20)
3:56.688 Waiting 2.100 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune unholy_strength, wail_of_svala, chaotic_energy(20)
3:58.788 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20)
4:00.111 howling_blast Fluffy_Pillow 35.0/100: 35% runic_power | 0.0/6: 0% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
4:01.434 frost_strike Fluffy_Pillow 37.0/100: 37% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, chaotic_energy(20)
4:02.758 pillar_of_frost Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
4:02.758 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:04.081 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
4:05.403 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:06.725 Waiting 4.800 sec 11.0/100: 11% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:11.525 obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, chaotic_energy(20)
4:12.849 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
4:14.173 remorseless_winter Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
4:15.636 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
4:16.960 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
4:18.284 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:19.608 Waiting 0.700 sec 16.0/100: 16% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:20.308 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:21.632 howling_blast Fluffy_Pillow 38.0/100: 38% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
4:22.955 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
4:24.277 Waiting 0.900 sec 17.0/100: 17% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
4:25.177 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20)
4:26.501 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
4:27.826 howling_blast Fluffy_Pillow 14.0/100: 14% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
4:29.150 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
4:30.471 obliteration Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
4:30.471 frost_strike Fluffy_Pillow 51.0/100: 51% runic_power | 1.0/6: 17% rune obliteration, unholy_strength, chaotic_energy(20)
4:31.796 obliterate Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength, chaotic_energy(20)
4:33.120 frost_strike Fluffy_Pillow 53.0/100: 53% runic_power | 0.0/6: 0% rune obliteration, unholy_strength, chaotic_energy(20)
4:34.443 remorseless_winter Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:35.767 obliterate Fluffy_Pillow 40.0/100: 40% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:37.090 frost_strike Fluffy_Pillow 62.0/100: 62% runic_power | 0.0/6: 0% rune obliteration, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:38.413 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:39.735 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:41.059 howling_blast Fluffy_Pillow 41.0/100: 41% runic_power | 0.0/6: 0% rune rime, unholy_strength, dirge_of_angerboda, chaotic_energy(20)
4:42.381 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
4:43.704 Waiting 3.000 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
4:46.704 obliterate Fluffy_Pillow 22.0/100: 22% runic_power | 3.0/6: 50% rune unholy_strength, chaotic_energy(20)
4:48.028 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
4:49.350 howling_blast Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune killing_machine, rime, unholy_strength, chaotic_energy(20)
4:50.674 pillar_of_frost Fluffy_Pillow 21.0/100: 21% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
4:50.758 Waiting 0.800 sec 21.0/100: 21% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:51.558 obliterate Fluffy_Pillow 21.0/100: 21% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
4:52.884 howling_blast Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
4:54.207 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
4:55.531 remorseless_winter Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, chaotic_energy(20)
4:56.855 frost_strike Fluffy_Pillow 32.0/100: 32% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
4:58.178 Waiting 2.200 sec 7.0/100: 7% runic_power | 1.0/6: 17% rune pillar_of_frost, chaotic_energy(20)
5:00.378 obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 2.0/6: 33% rune pillar_of_frost, chaotic_energy(20)
5:01.701 frost_strike Fluffy_Pillow 31.0/100: 31% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, chaotic_energy(20)
5:03.025 howling_blast Fluffy_Pillow 8.0/100: 8% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, chaotic_energy(20)
5:04.349 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune pillar_of_frost, chaotic_energy(20)
5:05.673 frost_strike Fluffy_Pillow 43.0/100: 43% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, chaotic_energy(20)
5:06.997 Waiting 5.100 sec 20.0/100: 20% runic_power | 0.0/6: 0% rune killing_machine, pillar_of_frost, chaotic_energy(20)
5:12.097 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
5:13.419 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
5:14.742 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
5:16.064 remorseless_winter Fluffy_Pillow 3.0/100: 3% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
5:17.389 Waiting 4.500 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
5:21.889 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
5:23.214 frost_strike Fluffy_Pillow 41.0/100: 41% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
5:24.538 howling_blast Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
5:25.860 Waiting 0.900 sec 18.0/100: 18% runic_power | 1.0/6: 17% rune chaotic_energy(20)
5:26.760 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune chaotic_energy(20)
5:28.083 frost_strike Fluffy_Pillow 40.0/100: 40% runic_power | 0.0/6: 0% rune chaotic_energy(20)
5:29.405 Waiting 1.300 sec 17.0/100: 17% runic_power | 1.0/6: 17% rune chaotic_energy(20)
5:30.705 obliterate Fluffy_Pillow 17.0/100: 17% runic_power | 3.0/6: 50% rune chaotic_energy(20)
5:32.030 frost_strike Fluffy_Pillow 39.0/100: 39% runic_power | 1.0/6: 17% rune chaotic_energy(20)
5:33.355 Waiting 2.200 sec 16.0/100: 16% runic_power | 1.0/6: 17% rune chaotic_energy(20)
5:35.555 obliterate Fluffy_Pillow 18.0/100: 18% runic_power | 2.0/6: 33% rune dirge_of_angerboda, chaotic_energy(20)
5:36.879 frost_strike Fluffy_Pillow 38.0/100: 38% runic_power | 0.0/6: 0% rune dirge_of_angerboda, chaotic_energy(20)
5:38.202 Waiting 1.300 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune dirge_of_angerboda, chaotic_energy(20)
5:39.502 remorseless_winter Fluffy_Pillow 17.0/100: 17% runic_power | 2.0/6: 33% rune howl_of_ingvar, dirge_of_angerboda, chaotic_energy(20)
5:40.826 pillar_of_frost Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune howl_of_ingvar, dirge_of_angerboda, chaotic_energy(20)
5:40.826 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune pillar_of_frost, howl_of_ingvar, dirge_of_angerboda, chaotic_energy(20)
5:42.149 Waiting 2.200 sec 4.0/100: 4% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, howl_of_ingvar, dirge_of_angerboda, chaotic_energy(20)
5:44.349 obliterate Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, howl_of_ingvar, chaotic_energy(20)
5:45.671 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, howl_of_ingvar, chaotic_energy(20)
5:46.993 frost_strike Fluffy_Pillow 28.0/100: 28% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
5:48.315 obliterate Fluffy_Pillow 5.0/100: 5% runic_power | 3.0/6: 50% rune pillar_of_frost, unholy_strength, howl_of_ingvar, chaotic_energy(20)
5:49.639 howling_blast Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
5:50.963 frost_strike Fluffy_Pillow 27.0/100: 27% runic_power | 1.0/6: 17% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
5:52.285 obliterate Fluffy_Pillow 9.0/100: 9% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
5:53.608 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
5:54.931 howling_blast Fluffy_Pillow 6.0/100: 6% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
5:56.254 obliterate Fluffy_Pillow 8.0/100: 8% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
5:57.577 howling_blast Fluffy_Pillow 28.0/100: 28% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
5:58.900 obliterate Fluffy_Pillow 30.0/100: 30% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:00.224 obliteration Fluffy_Pillow 52.0/100: 52% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:00.471 frost_strike Fluffy_Pillow 52.0/100: 52% runic_power | 0.0/6: 0% rune obliteration, pillar_of_frost, chaotic_energy(20)
6:01.795 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 0.0/6: 0% rune killing_machine, obliteration, chaotic_energy(20)
6:03.121 remorseless_winter Fluffy_Pillow 4.0/100: 4% runic_power | 2.0/6: 33% rune killing_machine, obliteration, chaotic_energy(20)
6:04.445 obliterate Fluffy_Pillow 16.0/100: 16% runic_power | 1.0/6: 17% rune killing_machine, obliteration, unholy_strength, chaotic_energy(20)
6:05.770 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune obliteration, unholy_strength, chaotic_energy(20)
6:07.094 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 2.0/6: 33% rune killing_machine, obliteration, unholy_strength, chaotic_energy(20)
6:08.419 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune obliteration, unholy_strength, chaotic_energy(20)
6:09.743 Waiting 1.000 sec 10.0/100: 10% runic_power | 1.0/6: 17% rune killing_machine, unholy_strength, chaotic_energy(20)
6:10.743 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
6:12.067 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
6:13.389 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
6:14.712 obliterate Fluffy_Pillow 11.0/100: 11% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20)
6:16.037 frost_strike Fluffy_Pillow 36.0/100: 36% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
6:17.362 howling_blast Fluffy_Pillow 13.0/100: 13% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
6:18.685 Waiting 4.200 sec 15.0/100: 15% runic_power | 0.0/6: 0% rune unholy_strength, chaotic_energy(20)
6:22.885 remorseless_winter Fluffy_Pillow 19.0/100: 19% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
6:24.444 obliterate Fluffy_Pillow 36.0/100: 36% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20)
6:25.767 frost_strike Fluffy_Pillow 69.0/100: 69% runic_power | 0.0/6: 0% rune rime, unholy_strength, chaotic_energy(20)
6:27.092 howling_blast Fluffy_Pillow 46.0/100: 46% runic_power | 1.0/6: 17% rune rime, unholy_strength, chaotic_energy(20)
6:28.414 pillar_of_frost Fluffy_Pillow 48.0/100: 48% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, chaotic_energy(20)
6:28.414 obliterate Fluffy_Pillow 48.0/100: 48% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
6:29.738 frost_strike Fluffy_Pillow 68.0/100: 68% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:31.062 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:32.383 obliterate Fluffy_Pillow 20.0/100: 20% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:33.707 frost_strike Fluffy_Pillow 42.0/100: 42% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:35.029 empower_rune_weapon Fluffy_Pillow 19.0/100: 19% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:35.029 obliterate Fluffy_Pillow 19.0/100: 19% runic_power | 6.0/6: 100% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:36.353 obliterate Fluffy_Pillow 39.0/100: 39% runic_power | 4.0/6: 67% rune pillar_of_frost, unholy_strength, chaotic_energy(20)
6:37.675 frost_strike Fluffy_Pillow 61.0/100: 61% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
6:38.865 howling_blast Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, rime, unholy_strength, wail_of_svala, chaotic_energy(20)
6:40.054 obliterate Fluffy_Pillow 38.0/100: 38% runic_power | 2.0/6: 33% rune killing_machine, pillar_of_frost, unholy_strength, wail_of_svala, chaotic_energy(20)
6:41.242 howling_blast Fluffy_Pillow 60.0/100: 60% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, unholy_strength, wail_of_svala, chaotic_energy(20)
6:42.430 frost_strike Fluffy_Pillow 62.0/100: 62% runic_power | 0.0/6: 0% rune pillar_of_frost, unholy_strength, wail_of_svala, chaotic_energy(20)
6:43.618 remorseless_winter Fluffy_Pillow 37.0/100: 37% runic_power | 2.0/6: 33% rune pillar_of_frost, unholy_strength, wail_of_svala, chaotic_energy(20)
6:44.808 obliterate Fluffy_Pillow 49.0/100: 49% runic_power | 2.0/6: 33% rune pillar_of_frost, wail_of_svala, chaotic_energy(20)
6:46.029 howling_blast Fluffy_Pillow 71.0/100: 71% runic_power | 0.0/6: 0% rune pillar_of_frost, rime, chaotic_energy(20)
6:47.352 frost_strike Fluffy_Pillow 71.0/100: 71% runic_power | 0.0/6: 0% rune pillar_of_frost, chaotic_energy(20)
6:48.544 frost_strike Fluffy_Pillow 48.0/100: 48% runic_power | 0.0/6: 0% rune killing_machine, wail_of_svala, chaotic_energy(20)
6:49.733 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, wail_of_svala, chaotic_energy(20)
6:50.922 Waiting 0.400 sec 0.0/100: 0% runic_power | 0.0/6: 0% rune killing_machine, unholy_strength, wail_of_svala, chaotic_energy(20)
6:51.322 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 2.0/6: 33% rune killing_machine, unholy_strength, wail_of_svala, chaotic_energy(20)
6:52.510 Waiting 1.500 sec 22.0/100: 22% runic_power | 1.0/6: 17% rune unholy_strength, wail_of_svala, chaotic_energy(20)
6:54.010 frost_strike Fluffy_Pillow 29.0/100: 29% runic_power | 1.0/6: 17% rune unholy_strength, wail_of_svala, chaotic_energy(20)
6:55.198 Waiting 4.400 sec 6.0/100: 6% runic_power | 1.0/6: 17% rune unholy_strength, wail_of_svala, chaotic_energy(20)
6:59.598 obliterate Fluffy_Pillow 10.0/100: 10% runic_power | 3.0/6: 50% rune killing_machine, unholy_strength, chaotic_energy(20)
7:00.920 frost_strike Fluffy_Pillow 35.0/100: 35% runic_power | 1.0/6: 17% rune unholy_strength, chaotic_energy(20)
7:02.244 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 2.0/6: 33% rune unholy_strength, chaotic_energy(20)
7:03.568 howling_blast Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune rime, chaotic_energy(20)
7:04.890 frost_strike Fluffy_Pillow 34.0/100: 34% runic_power | 0.0/6: 0% rune chaotic_energy(20)
7:06.213 remorseless_winter Fluffy_Pillow 11.0/100: 11% runic_power | 1.0/6: 17% rune chaotic_energy(20)
7:07.536 Waiting 0.900 sec 23.0/100: 23% runic_power | 0.0/6: 0% rune chaotic_energy(20)
7:08.436 obliterate Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune chaotic_energy(20)
7:09.758 frost_strike Fluffy_Pillow 45.0/100: 45% runic_power | 1.0/6: 17% rune rime, chaotic_energy(20)
7:11.081 howling_blast Fluffy_Pillow 20.0/100: 20% runic_power | 1.0/6: 17% rune rime, chaotic_energy(20)
7:12.404 Waiting 3.100 sec 22.0/100: 22% runic_power | 1.0/6: 17% rune chaotic_energy(20)
7:15.504 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune chaotic_energy(20)
7:16.827 Waiting 0.400 sec 1.0/100: 1% runic_power | 1.0/6: 17% rune chaotic_energy(20)
7:17.227 obliterate Fluffy_Pillow 1.0/100: 1% runic_power | 3.0/6: 50% rune chaotic_energy(20)
7:18.548 pillar_of_frost Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune rime, chaotic_energy(20)
7:18.548 howling_blast Fluffy_Pillow 23.0/100: 23% runic_power | 2.0/6: 33% rune pillar_of_frost, rime, chaotic_energy(20)
7:19.871 frost_strike Fluffy_Pillow 25.0/100: 25% runic_power | 2.0/6: 33% rune pillar_of_frost, chaotic_energy(20)
7:21.194 obliterate Fluffy_Pillow 0.0/100: 0% runic_power | 3.0/6: 50% rune pillar_of_frost, chaotic_energy(20)
7:22.518 Waiting 3.200 sec 22.0/100: 22% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, chaotic_energy(20)
7:25.718 frost_strike Fluffy_Pillow 26.0/100: 26% runic_power | 1.0/6: 17% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
7:27.041 remorseless_winter Fluffy_Pillow 1.0/100: 1% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
7:28.364 obliterate Fluffy_Pillow 13.0/100: 13% runic_power | 3.0/6: 50% rune killing_machine, pillar_of_frost, unholy_strength, chaotic_energy(20)
7:29.687 frost_strike Fluffy_Pillow 33.0/100: 33% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
7:31.011 obliteration Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
7:31.011 howling_blast Fluffy_Pillow 10.0/100: 10% runic_power | 1.0/6: 17% rune obliteration, pillar_of_frost, rime, unholy_strength, chaotic_energy(20)
7:32.285 obliterate Fluffy_Pillow 12.0/100: 12% runic_power | 1.0/6: 17% rune obliteration, pillar_of_frost, unholy_strength, wail_of_svala, chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 24816 23109 11778 (9218)
Agility 7857 7532 0
Stamina 29997 29997 19163
Intellect 4327 4002 0
Spirit 0 0 0
Health 1799820 1799820 0
Runic Power 100 100 0
Rune 6 6 0
Crit 24.84% 23.75% 6563
Haste 13.65% 13.65% 4436
Swing Speed 27.29% 27.29% 4436
Damage / Heal Versatility 4.53% 4.53% 1811
Attack Power 24816 23109 0
Mastery 32.54% 32.54% 4793
Armor 4057 4057 4057
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 852.00
Local Head Deathlord's Helm
ilevel: 840, stats: { 542 Armor, +1772 Sta, +1182 Str, +791 Haste, +467 Crit }
Local Neck Manapearl Choker
ilevel: 850, stats: { +1094 Sta, +1049 Mastery, +786 Vers }
Local Shoulders Portalguard Shoulders
ilevel: 855, stats: { 518 Armor, +1019 StrInt, +1529 Sta, +677 Crit, +320 Vers }
Local Chest Horror Inscribed Chestguard
ilevel: 850, stats: { 683 Armor, +1945 Sta, +1297 StrInt, +932 Crit, +372 Haste }
Local Waist Greatbelt of Alpha Dominance
ilevel: 840, stats: { 376 Armor, +1329 Sta, +886 StrInt, +633 Crit, +310 Haste }
Local Legs Skoldiir Legguards
ilevel: 850, stats: { 597 Armor, +1297 StrInt, +1945 Sta, +904 Crit, +400 Mastery }
Local Feet Nightsfall Sabatons
ilevel: 850, stats: { 469 Armor, +973 StrInt, +1459 Sta, +594 Haste, +385 Mastery }
Local Wrists Dragonbone Wristclamps
ilevel: 865, stats: { 309 Armor, +1258 Sta, +839 StrInt, +521 Mastery, +255 Haste }
Local Hands Fitted Ironbark Gauntlets
ilevel: 855, stats: { 431 Armor, +1529 Sta, +1019 StrInt, +648 Haste, +349 Mastery }
Local Finger1 Band of the Wyrm Matron
ilevel: 845, stats: { +1045 Sta, +1132 Crit, +669 Vers }, enchant: { +200 Crit }
Local Finger2 Signet of the Highborne Magi
ilevel: 845, stats: { +1045 Sta, +1132 Mastery, +669 Crit }, enchant: { +200 Crit }
Local Trinket1 Memento of Angerboda
ilevel: 840, stats: { +1123 StrAgi }
Local Trinket2 Chaos Talisman
ilevel: 840, stats: { +898 Haste }
Local Back Seacursed Wrap
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +481 Haste, +267 Mastery }
Local Main Hand Blades of the Fallen Prince
ilevel: 873, weapon: { 4083 - 7584, 2.6 }, stats: { +689 Str, +1033 Sta, +310 Crit, +298 Mastery }, enchant: rune_of_razorice, relics: { +40 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Blades of the Fallen Prince
ilevel: 873, weapon: { 4083 - 7584, 2.6 }, stats: { +689 Str, +1033 Sta, +310 Crit, +298 Mastery }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Shattering Strikes (Frost Death Knight) Icy Talons (Frost Death Knight) Murderous Efficiency (Frost Death Knight)
30 Freezing Fog (Frost Death Knight) Frozen Pulse (Frost Death Knight) Horn of Winter (Frost Death Knight)
45 Icecap (Frost Death Knight) Hungering Rune Weapon (Frost Death Knight) Avalanche (Frost Death Knight)
60 Abomination's Might (Frost Death Knight) Blinding Sleet (Frost Death Knight) Winter is Coming (Frost Death Knight)
75 Volatile Shielding (Frost Death Knight) Permafrost (Frost Death Knight) White Walker (Frost Death Knight)
90 Frostscythe (Frost Death Knight) Runic Attenuation (Frost Death Knight) Gathering Storm (Frost Death Knight)
100 Obliteration (Frost Death Knight) Breath of Sindragosa (Frost Death Knight) Glacial Advance (Frost Death Knight)

Profile

deathknight="Wadzak"
origin="https://eu.api.battle.net/wow/character/hyjal/Wadzak/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/146/135744402-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=200/herbalism=99
talents=http://eu.battle.net/wow/en/tool/talent-calculator#dZ!0002110
artifact=12:0:0:0:0:108:2:109:3:111:3:113:3:115:3:119:1:122:1:1091:1:1092:1:1332:1
spec=frost

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=countless_armies
actions.precombat+=/food,name=the_hungry_magister
actions.precombat+=/augmentation,name=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/pillar_of_frost
actions+=/arcane_torrent,if=runic_power.deficit>20
actions+=/blood_fury,if=!talent.breath_of_sindragosa.enabled|dot.breath_of_sindragosa.ticking
actions+=/berserking,if=buff.pillar_of_frost.up
actions+=/potion,name=old_war
actions+=/sindragosas_fury,if=buff.pillar_of_frost.up
actions+=/obliteration
actions+=/breath_of_sindragosa,if=runic_power>=50
actions+=/run_action_list,name=bos,if=dot.breath_of_sindragosa.ticking
actions+=/call_action_list,name=shatter,if=talent.shattering_strikes.enabled
actions+=/call_action_list,name=icytalons,if=talent.icy_talons.enabled
actions+=/call_action_list,name=generic,if=(!talent.shattering_strikes.enabled&!talent.icy_talons.enabled)

actions.bos=howling_blast,target_if=!dot.frost_fever.ticking
actions.bos+=/call_action_list,name=core
actions.bos+=/horn_of_winter
actions.bos+=/empower_rune_weapon,if=runic_power<=70
actions.bos+=/hungering_rune_weapon
actions.bos+=/howling_blast,if=buff.rime.react

actions.core=remorseless_winter,if=artifact.frozen_soul.enabled
actions.core+=/glacial_advance
actions.core+=/frost_strike,if=buff.obliteration.up&!buff.killing_machine.react
actions.core+=/remorseless_winter,if=spell_targets.remorseless_winter>=2
actions.core+=/frostscythe,if=!talent.breath_of_sindragosa.enabled&(buff.killing_machine.react|spell_targets.frostscythe>=4)
actions.core+=/obliterate,if=buff.killing_machine.react
actions.core+=/obliterate
actions.core+=/remorseless_winter
actions.core+=/frostscythe,if=talent.frozen_pulse.enabled
actions.core+=/howling_blast,if=talent.frozen_pulse.enabled

actions.generic=howling_blast,target_if=!dot.frost_fever.ticking
actions.generic+=/howling_blast,if=buff.rime.react
actions.generic+=/frost_strike,if=runic_power>=80
actions.generic+=/call_action_list,name=core
actions.generic+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.generic+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.generic+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.icytalons=frost_strike,if=buff.icy_talons.remains<1.5
actions.icytalons+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.icytalons+=/howling_blast,if=buff.rime.react
actions.icytalons+=/frost_strike,if=runic_power>=80|buff.icy_talons.stack<3
actions.icytalons+=/call_action_list,name=core
actions.icytalons+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.icytalons+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.icytalons+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

actions.shatter=frost_strike,if=debuff.razorice.stack=5
actions.shatter+=/howling_blast,target_if=!dot.frost_fever.ticking
actions.shatter+=/howling_blast,if=buff.rime.react
actions.shatter+=/frost_strike,if=runic_power>=80
actions.shatter+=/call_action_list,name=core
actions.shatter+=/horn_of_winter,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/horn_of_winter,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/frost_strike,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/frost_strike,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/empower_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/hungering_rune_weapon,if=talent.breath_of_sindragosa.enabled&cooldown.breath_of_sindragosa.remains>15
actions.shatter+=/empower_rune_weapon,if=!talent.breath_of_sindragosa.enabled
actions.shatter+=/hungering_rune_weapon,if=!talent.breath_of_sindragosa.enabled

head=deathlords_helm,id=139676,bonus_id=3385/3384
neck=manapearl_choker,id=134249,bonus_id=3432/1512/3337
shoulders=portalguard_shoulders,id=134360,bonus_id=3410/1808/1517/3336
back=seacursed_wrap,id=133771,bonus_id=3413/1507/3336
chest=horror_inscribed_chestguard,id=138216,bonus_id=1807/1472
wrists=dragonbone_wristclamps,id=138218,bonus_id=1805/1487
hands=fitted_ironbark_gauntlets,id=139225,bonus_id=1807/1477/3336
waist=greatbelt_of_alpha_dominance,id=136773,bonus_id=1727/1492/1813
legs=skoldiir_legguards,id=134183,bonus_id=1727/1808/1512/3336
feet=nightsfall_sabatons,id=139061,bonus_id=3432/1512/3337
finger1=band_of_the_wyrm_matron,id=134524,bonus_id=3410/1497/1813,enchant=200crit
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1726/1497/3337,enchant=200crit
trinket1=memento_of_angerboda,id=133644,bonus_id=1727/1492/1813
trinket2=chaos_talisman,id=137459,bonus_id=1727/1492/1813
main_hand=blades_of_the_fallen_prince,id=128292,bonus_id=717,gem_id=137380/139268/141267/0,relic_id=1727:1492:1813/1807:1472/3432:1502:3336/0,enchant=rune_of_razorice
off_hand=blades_of_the_fallen_prince,id=128293,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=851.63
# gear_strength=11778
# gear_stamina=19163
# gear_crit_rating=6434
# gear_haste_rating=4349
# gear_mastery_rating=4699
# gear_versatility_rating=1775
# gear_armor=4057

Kaptah

Kaptah : 212313 dps

  • Race: Night Elf
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
212313.0 212313.0 94.6 / 0.045% 19047.1 / 9.0% 35995.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
5.9 5.9 Astral Power 0.00% 41.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Kaptah/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Shooting Stars (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • alchemy: 777
  • engineering: 716

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kaptah 212313
Deadly Grace 6902 3.2% 23.2 10.17sec 131844 0 Direct 23.2 108919 217903 131849 21.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.20 23.20 0.00 0.00 0.0000 0.0000 3058983.21 3058983.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.32 78.97% 108918.76 91885 119450 108913.12 99402 117612 1995524 1995524 0.00
crit 4.88 21.03% 217903.08 183769 238900 216816.58 0 238900 1063459 1063459 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 15664 7.4% 10.4 44.68sec 676803 247218 Direct 9.7 599920 1199840 727712 21.3%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.43 9.70 0.00 0.00 2.7377 0.0000 7061043.35 7061043.35 0.00 247218.10 247218.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.64 78.70% 599919.89 599920 599920 599919.89 599920 599920 4581086 4581086 0.00
crit 2.07 21.30% 1199839.79 1199840 1199840 1082963.70 0 1199840 2479957 2479957 0.00
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and all enemies near the target, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 8659 4.1% 10.8 43.37sec 362171 202608 Direct 10.7 299961 599921 363080 21.0%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.76 10.73 0.00 0.00 1.7876 0.0000 3897566.91 3897566.91 0.00 202607.83 202607.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.47 78.95% 299960.53 299961 299961 299960.53 299961 299961 2542150 2542150 0.00
crit 2.26 21.05% 599921.05 599921 599921 550302.62 0 599921 1355417 1355417 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 33124 15.6% 58.3 7.58sec 255774 140870 Direct 58.3 195065 390043 255770 31.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.32 58.32 0.00 0.00 1.8157 0.0000 14917456.02 14917456.02 0.00 140870.26 140870.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.16 68.86% 195065.44 188104 244536 195106.73 188104 203905 7834408 7834408 0.00
crit 18.16 31.14% 390042.98 376209 489072 390116.38 376209 427510 7083048 7083048 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 17341 8.2% 21.1 22.03sec 370498 267273 Direct 21.1 44261 88463 53532 21.0%  
Periodic 247.9 22249 44504 26943 21.1% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.08 21.08 247.94 247.94 1.3862 1.8136 7808657.92 7808657.92 0.00 16306.26 267273.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.66 79.03% 44260.65 43152 56098 44271.55 43152 46389 737212 737212 0.00
crit 4.42 20.97% 88463.45 86304 112196 87693.48 0 112196 391000 391000 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 195.6 78.91% 22249.06 961 28050 22252.48 21943 22593 4352884 4352884 0.00
crit 52.3 21.09% 44504.23 7320 56100 44512.26 42602 46943 2327562 2327562 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}. Usable while in Bear Form.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 4465 2.1% 10.1 44.35sec 199078 145356 Direct 11.1 149981 299962 181603 21.1%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 11.06 0.00 0.00 1.3696 0.0000 2009254.32 2009254.32 0.00 145355.88 145355.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.73 78.91% 149980.84 149981 149981 149980.84 149981 149981 1309464 1309464 0.00
crit 2.33 21.09% 299961.69 299962 299962 278242.29 0 299962 699791 699791 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rancid Maw 9391 4.4% 18.7 23.51sec 226205 0 Direct 18.6 187638 375065 226818 20.9%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.69 18.64 0.00 0.00 0.0000 0.0000 4228768.30 4228768.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.75 79.10% 187637.54 182544 237307 187636.92 182544 209925 2767119 2767119 0.00
crit 3.90 20.90% 375065.26 365087 474614 368712.69 0 474614 1461649 1461649 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:149425.50
  • base_dd_max:165154.50
 
Shooting Stars 1761 0.8% 49.5 8.92sec 16041 0 Direct 45.5 14433 28878 17464 21.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.50 45.47 0.00 0.00 0.0000 0.0000 794007.47 794007.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.93 79.02% 14432.80 13998 18198 14432.60 13998 15545 518529 518529 0.00
crit 9.54 20.98% 28877.58 27996 36395 28872.79 0 36395 275479 275479 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a {$s1=10}% chance to call down a falling star, dealing $202497m1 Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.420000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Solar Wrath 33757 15.9% 105.1 4.22sec 144711 119075 Direct 104.7 119885 239764 145172 21.1%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.05 104.72 0.00 0.00 1.2153 0.0000 15202294.22 15202294.22 0.00 119074.91 119074.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.63 78.90% 119884.73 77724 189432 119912.55 110071 128249 9905571 9905571 0.00
crit 22.09 21.10% 239764.27 155448 378865 239807.67 176369 295322 5296723 5296723 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 41755 (49040) 19.7% (23.1%) 59.1 7.56sec 373402 274197 Direct 59.0 263176 526419 318663 21.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.13 58.99 0.00 0.00 1.3618 0.0000 18799228.79 18799228.79 0.00 274197.17 274197.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.56 78.92% 263176.24 251188 326544 263237.80 253341 271555 12253109 12253109 0.00
crit 12.44 21.08% 526418.71 502376 653089 526482.61 502376 627970 6546119 6546119 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively. You can accumulate up to {$164547u=3} of each Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 7286 3.4% 19.5 22.61sec 168460 0 Direct 19.4 139695 279274 169034 21.0%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.47 19.40 0.00 0.00 0.0000 0.0000 3279675.74 3279675.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.32 78.98% 139694.71 133315 173310 139731.66 133315 156169 2140615 2140615 0.00
crit 4.08 21.02% 279274.14 266631 346620 274204.17 0 346620 1139061 1139061 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Stellar Flare 18253 8.6% 19.3 23.75sec 425670 311131 Direct 19.3 67611 135240 81876 21.1%  
Periodic 245.7 22319 44633 27021 21.1% 99.0%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.31 19.31 245.74 245.74 1.3682 1.8157 8221321.70 8221321.70 0.00 17395.87 311130.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.24 78.91% 67611.44 66659 86656 67595.72 66659 71658 1030397 1030397 0.00
crit 4.07 21.09% 135239.56 133318 173313 133760.51 0 173313 550947 550947 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 194.0 78.93% 22318.59 1221 28164 22321.85 21955 22644 4328777 4328777 0.00
crit 51.8 21.07% 44633.21 2582 56329 44640.40 43330 47194 2311200 2311200 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<4&remains<7.2&astral_power>=15
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 13956 6.6% 13.9 33.39sec 450916 332718 Direct 13.9 37351 74701 45287 21.3%  
Periodic 247.5 18873 37748 22849 21.1% 99.5%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.94 247.45 247.45 1.3553 1.8114 6285367.36 6285367.36 0.00 13455.34 332717.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.98 78.75% 37350.63 36663 47662 37359.67 36663 39413 409986 409986 0.00
crit 2.96 21.25% 74700.95 73326 95323 71498.97 0 95323 221296 221296 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 195.3 78.93% 18872.99 10 23832 18875.52 18529 19162 3686297 3686297 0.00
crit 52.1 21.07% 37748.09 20 47663 37752.39 36216 39689 1967788 1967788 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds} to the primary target and all enemies within $164815A2 yards.{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
Kaptah
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
Celestial Alignment 2.9 185.43sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kaptah
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.22% 0.0(0.0) 1.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.9 0.0 185.4sec 185.4sec 9.46% 9.52% 0.0(0.0) 2.8

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 51.0 8.2 8.8sec 7.6sec 67.45% 53.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • lunar_empowerment_1:58.18%
  • lunar_empowerment_2:9.26%
  • lunar_empowerment_3:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 194.5sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Solar Empowerment 56.6 2.5 7.9sec 7.6sec 37.73% 36.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • solar_empowerment_1:36.23%
  • solar_empowerment_2:1.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Kaptah
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects. While in this form, single-target attacks against you have a {$h=15}% chance make your next damaging spell instant. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:15.00%

Resources

Resource Usage Type Count Total Average RPE APR
Kaptah
starsurge Astral Power 59.1 2365.2 40.0 40.0 9335.0
stellar_flare Astral Power 19.3 289.7 15.0 15.0 28378.4
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 11.09 110.93 (4.15%) 10.00 0.00 0.00%
half_moon Astral Power 10.76 215.24 (8.04%) 20.00 0.00 0.00%
full_moon Astral Power 10.43 417.30 (15.59%) 40.00 0.00 0.00%
moonfire Astral Power 21.08 63.23 (2.36%) 3.00 0.00 0.00%
shooting_stars Astral Power 49.50 197.99 (7.40%) 4.00 0.00 0.00%
sunfire Astral Power 13.94 41.82 (1.56%) 3.00 0.00 0.00%
solar_wrath Astral Power 105.05 886.56 (33.13%) 8.44 0.00 0.00%
lunar_strike Astral Power 58.32 742.96 (27.76%) 12.74 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 5.94 5.89
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.63 0.00 90.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Kaptah Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Kaptah Damage Per Second
Count 9999
Mean 212313.04
Minimum 195217.79
Maximum 232743.63
Spread ( max - min ) 37525.83
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 4828.8754
5th Percentile 204725.55
95th Percentile 220664.09
( 95th Percentile - 5th Percentile ) 15938.54
Mean Distribution
Standard Deviation 48.2912
95.00% Confidence Intervall ( 212218.39 - 212407.69 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1987
0.1 Scale Factor Error with Delta=300 199056
0.05 Scale Factor Error with Delta=300 796224
0.01 Scale Factor Error with Delta=300 19905617
Priority Target DPS
Sample Data Kaptah Priority Target Damage Per Second
Count 9999
Mean 212313.04
Minimum 195217.79
Maximum 232743.63
Spread ( max - min ) 37525.83
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 4828.8754
5th Percentile 204725.55
95th Percentile 220664.09
( 95th Percentile - 5th Percentile ) 15938.54
Mean Distribution
Standard Deviation 48.2912
95.00% Confidence Intervall ( 212218.39 - 212407.69 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1987
0.1 Scale Factor Error with Delta=300 199056
0.05 Scale Factor Error with Delta=300 796224
0.01 Scale Factor Error with Delta=300 19905617
DPS(e)
Sample Data Kaptah Damage Per Second (Effective)
Count 9999
Mean 212313.04
Minimum 195217.79
Maximum 232743.63
Spread ( max - min ) 37525.83
Range [ ( max - min ) / 2 * 100% ] 8.84%
Damage
Sample Data Kaptah Damage
Count 9999
Mean 95563625.30
Minimum 72733976.46
Maximum 121483087.36
Spread ( max - min ) 48749110.91
Range [ ( max - min ) / 2 * 100% ] 25.51%
DTPS
Sample Data Kaptah Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kaptah Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Kaptah Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kaptah Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kaptah Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kaptah Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data KaptahTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Kaptah Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
B 0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
C 0.36 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
D 19.37 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
E 21.08 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
F 13.94 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
G 2.87 celestial_alignment,if=astral_power>=40
0.00 starfall,if=buff.oneths_overconfidence.up
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
H 0.02 lunar_strike,if=buff.lunar_empowerment.stack=3
I 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
J 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
K 9.41 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 9.01 solar_wrath,if=buff.solar_empowerment.up
M 7.72 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
N 3.41 solar_wrath
actions.single_target
# count action,conditions
O 10.11 new_moon,if=astral_power<=90
P 10.79 half_moon,if=astral_power<=80
Q 10.14 full_moon,if=astral_power<=60
0.00 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
R 49.72 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
S 49.85 solar_wrath,if=buff.solar_empowerment.up
T 50.82 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
0.00 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
U 43.06 solar_wrath

Sample Sequence

012367EFDPQGKLMKLMKLMKLEMDOURSTUUPRFSTRSTURESDQRSTTURSTOREFSTDUUUPRSTRSTEUURQDSTRFSTUOERSTRSTDUPRSTURESTFUQRDSTRSTUOERSTRSTUUDPFRSTEURSTQRSRSDTTUEG8KFLMKLMNKLMDOPERSTUQFRRSSTTDEORSTUURSTUPRSTDEFURSTQRSTRSTEDOUUURSTFUUPRSTERSDTUUQRRSSTTEFORDSTURSTUPRSETURSTDUQFRSTRESTOUGKLDMNNKLMNKEPFSRSTDQRSTTRESTOURSTFDUUURPESTRSTURSC

Sample Sequence Table

time name target resources buffs
Pre flask Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Kaptah 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.307 sunfire Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.386 stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.466 half_moon Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:04.903 full_moon Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:07.057 celestial_alignment Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:07.057 starsurge Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:08.137 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:09.003 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:10.439 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:11.519 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:12.383 lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:13.820 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:14.899 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:15.764 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:17.200 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:18.280 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:19.143 moonfire Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:20.223 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:21.656 stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:22.736 new_moon Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:23.815 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage bloodlust
0:24.894 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage bloodlust
0:25.973 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:26.837 lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:28.274 solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage bloodlust
0:29.355 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage bloodlust
0:30.433 half_moon Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage bloodlust
0:31.872 starsurge Fluffy_Pillow 63.0/100: 63% astral_power | 0.0/100: 0% rage bloodlust
0:32.952 sunfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:34.031 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:34.895 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:36.334 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage bloodlust
0:37.414 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment, solar_empowerment
0:38.279 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage bloodlust, lunar_empowerment
0:39.713 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust
0:40.793 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage bloodlust
0:42.134 moonfire Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:43.535 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:44.657 stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment
0:46.058 full_moon Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment
0:48.857 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage lunar_empowerment
0:50.257 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
0:51.379 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
0:53.246 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
0:55.114 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
0:56.516 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
0:57.918 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:59.040 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
1:00.905 new_moon Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
1:02.306 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
1:03.707 moonfire Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:05.109 sunfire Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:06.511 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:07.631 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
1:09.499 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
1:10.901 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage
1:12.303 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
1:13.706 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
1:15.107 half_moon Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
1:16.974 starsurge Fluffy_Pillow 63.0/100: 63% astral_power | 0.0/100: 0% rage
1:18.377 solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:19.498 lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage lunar_empowerment
1:21.365 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
1:22.766 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:23.886 lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment
1:25.754 moonfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage
1:27.157 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
1:28.558 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
1:29.959 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
1:31.362 full_moon Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:34.162 stellar_flare Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:35.564 solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:36.687 lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage lunar_empowerment
1:38.554 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
1:39.955 sunfire Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:41.356 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:42.478 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment
1:44.345 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
1:45.744 new_moon Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
1:47.145 moonfire Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage
1:48.547 starsurge Fluffy_Pillow 59.0/100: 59% astral_power | 0.0/100: 0% rage
1:49.949 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:51.070 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage lunar_empowerment
1:52.938 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
1:54.340 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:55.461 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
1:57.329 stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
1:58.730 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:00.132 half_moon Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:02.000 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
2:03.401 solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:04.523 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
2:06.392 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:07.794 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
2:09.197 moonfire Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:10.598 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:11.720 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
2:13.590 sunfire Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
2:14.992 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
2:16.392 full_moon Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:19.191 starsurge Fluffy_Pillow 82.0/100: 82% astral_power | 0.0/100: 0% rage
2:20.591 stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:21.994 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:23.116 lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage lunar_empowerment
2:24.983 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage
2:26.385 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:27.504 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
2:29.370 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
2:30.771 new_moon Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
2:32.172 moonfire Fluffy_Pillow 61.0/100: 61% astral_power | 0.0/100: 0% rage
2:33.574 starsurge Fluffy_Pillow 68.0/100: 68% astral_power | 0.0/100: 0% rage
2:34.975 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:36.098 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage lunar_empowerment
2:37.966 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
2:39.367 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:40.489 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
2:42.357 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
2:43.757 solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
2:45.159 stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
2:46.561 half_moon Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
2:48.428 sunfire Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
2:49.831 starsurge Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage
2:51.230 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:52.349 lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage lunar_empowerment
2:54.219 moonfire Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
2:55.621 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage
2:57.023 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
2:58.424 solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:59.546 lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage lunar_empowerment
3:01.413 full_moon Fluffy_Pillow 31.0/100: 31% astral_power | 0.0/100: 0% rage
3:04.213 starsurge Fluffy_Pillow 75.0/100: 75% astral_power | 0.0/100: 0% rage
3:05.614 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:06.737 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage lunar_empowerment
3:08.138 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:09.259 stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:10.659 lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:12.528 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
3:14.397 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
3:15.800 moonfire Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
3:17.203 celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
3:17.203 potion Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage celestial_alignment
3:17.203 starsurge Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:18.604 sunfire Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:20.006 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:21.129 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:22.995 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:24.398 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:25.521 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:27.389 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:28.790 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:30.191 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:31.312 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:33.180 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:34.584 new_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:35.984 half_moon Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:37.852 moonfire Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:39.255 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:40.655 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:41.777 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment, potion_of_deadly_grace
3:43.644 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
3:45.047 full_moon Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
3:47.845 sunfire Fluffy_Pillow 80.0/100: 80% astral_power | 0.0/100: 0% rage
3:49.245 starsurge Fluffy_Pillow 83.0/100: 83% astral_power | 0.0/100: 0% rage
3:50.647 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:52.050 solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2)
3:53.172 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
3:54.291 lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
3:56.157 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage lunar_empowerment
3:58.024 stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power | 0.0/100: 0% rage
3:59.424 moonfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
4:00.825 new_moon Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
4:02.227 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
4:03.627 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:04.747 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
4:06.614 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
4:08.016 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
4:09.417 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
4:10.819 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:11.942 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
4:13.809 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
4:15.212 half_moon Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
4:17.078 starsurge Fluffy_Pillow 57.0/100: 57% astral_power | 0.0/100: 0% rage
4:18.478 solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:19.599 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
4:21.467 stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
4:22.868 moonfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:24.270 sunfire Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
4:25.669 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
4:27.072 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
4:28.473 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:29.594 lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
4:31.462 full_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
4:34.260 starsurge Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
4:35.663 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:36.784 lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment
4:38.651 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
4:40.054 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:41.176 lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
4:43.043 moonfire Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
4:44.445 stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage
4:45.846 new_moon Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage
4:47.248 solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage
4:48.648 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:50.050 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
4:51.452 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
4:52.854 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:53.976 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
4:55.843 sunfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:57.245 solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power | 0.0/100: 0% rage
4:58.648 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage
5:00.050 half_moon Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
5:01.918 starsurge Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
5:03.320 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:04.442 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
5:06.310 moonfire Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
5:07.710 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
5:09.114 solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:10.235 stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
5:11.636 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment
5:13.504 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage
5:14.905 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
5:16.310 full_moon Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
5:19.110 starsurge Fluffy_Pillow 85.0/100: 85% astral_power | 0.0/100: 0% rage
5:20.513 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:21.914 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment(2)
5:23.034 solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
5:24.155 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
5:26.022 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
5:27.890 moonfire Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage
5:29.291 sunfire Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
5:30.690 new_moon Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage
5:32.091 starsurge Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
5:33.493 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:34.893 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:36.016 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
5:37.884 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
5:39.286 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
5:40.687 solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:41.808 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
5:43.674 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage
5:45.076 half_moon Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
5:46.944 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
5:48.346 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:49.465 moonfire Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
5:50.865 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage lunar_empowerment
5:52.732 solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage
5:54.134 starsurge Fluffy_Pillow 41.0/100: 41% astral_power | 0.0/100: 0% rage
5:55.536 solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:56.656 lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage lunar_empowerment
5:58.525 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
5:59.925 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:01.324 full_moon Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage
6:04.124 sunfire Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage
6:05.527 starsurge Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
6:06.927 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:08.049 lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
6:09.917 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
6:11.317 moonfire Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:12.718 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:13.839 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
6:15.705 new_moon Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
6:17.105 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
6:18.506 celestial_alignment Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
6:18.506 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage celestial_alignment
6:19.910 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:21.031 stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:22.431 lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:24.299 solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage celestial_alignment
6:25.698 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage celestial_alignment
6:27.102 starsurge Fluffy_Pillow 49.0/100: 49% astral_power | 0.0/100: 0% rage celestial_alignment
6:28.505 solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:29.626 lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:31.495 solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power | 0.0/100: 0% rage celestial_alignment
6:32.896 starsurge Fluffy_Pillow 51.0/100: 51% astral_power | 0.0/100: 0% rage celestial_alignment
6:34.298 moonfire Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:35.699 half_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:37.566 sunfire Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:38.969 solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:40.091 starsurge Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage lunar_empowerment
6:41.493 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
6:42.615 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
6:44.483 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
6:45.884 full_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
6:48.683 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage lunar_empowerment
6:50.085 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment(2), solar_empowerment
6:51.207 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment(2)
6:53.075 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage lunar_empowerment
6:54.943 starsurge Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
6:56.343 moonfire Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:57.743 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:58.864 lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
7:00.732 new_moon Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
7:02.135 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
7:03.535 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
7:04.936 solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:06.057 lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power | 0.0/100: 0% rage lunar_empowerment
7:07.924 sunfire Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
7:09.325 stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
7:10.725 solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power | 0.0/100: 0% rage
7:12.127 solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power | 0.0/100: 0% rage
7:13.529 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
7:14.931 starsurge Fluffy_Pillow 43.0/100: 43% astral_power | 0.0/100: 0% rage
7:16.333 half_moon Fluffy_Pillow 3.0/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:18.200 moonfire Fluffy_Pillow 23.0/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:19.600 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:20.722 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage lunar_empowerment
7:22.588 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
7:23.991 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:25.114 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage lunar_empowerment
7:26.980 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
7:28.381 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
7:29.782 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
7:30.904 full_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 9359 9034 0
Stamina 28184 28184 18738
Intellect 28718 27011 18398 (8899)
Spirit 0 0 0
Health 1691040 1691040 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 28718 27011 0
Crit 21.07% 21.07% 5276
Haste 7.32% 6.16% 2003
Damage / Heal Versatility 5.50% 5.50% 2202
Attack Power 9359 9034 0
Mastery 67.48% 67.48% 9009
Armor 5982 1994 1994
Run Speed 7 0 539

Gear

Source Slot Average Item Level: 846.00
Local Head Cowl of Fright
ilevel: 855, stats: { 272 Armor, +2038 Sta, +1359 AgiInt, +865 Mastery, +465 Crit, +775 unknown }
Local Neck Krakentooth Necklace
ilevel: 865, stats: { +1258 Sta, +1331 Mastery, +610 Vers }, enchant: { +75 Mastery }
Local Shoulders Charskin Mantle
ilevel: 845, stats: { 243 Armor, +1393 Sta, +929 AgiInt, +625 Vers, +336 Crit }
Local Shirt Darnassus Doublet
ilevel: 1
Local Chest Felbat Leather Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +853 Crit, +404 Vers, +539 RunSpeed }
Local Waist Dreadleather Belt of the Feverflare
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +490 Haste, +490 Mastery }
Local Legs Dreadhide Leggings
ilevel: 845, stats: { 283 Armor, +1238 AgiInt, +1857 Sta, +750 Crit, +531 Haste }
Local Feet Shadow Stalker Boots
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +563 Vers, +398 Haste }
Local Wrists Biornskin Bracer
ilevel: 830, stats: { 135 Armor, +605 AgiInt, +908 Sta, +462 Crit, +219 Mastery }
Local Hands Grips of Silent Screams
ilevel: 855, stats: { 209 Armor, +1529 Sta, +1019 AgiInt, +584 Haste, +413 Mastery }
Local Finger1 Shadowruby Band of the Peerless
ilevel: 850, stats: { +1094 Sta, +1049 Mastery, +786 Crit }, gems: { +100 Mastery }, enchant: { +150 Mastery }
Local Finger2 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }, enchant: { +150 Mastery }
Local Trinket1 Nightmare Bloom
ilevel: 825, stats: { +977 Int, +849 Mastery }, gems: { +100 Mastery }
Local Trinket2 Naraxas' Spiked Tongue
ilevel: 840, stats: { +898 Mastery }
Local Back Drape of Vile Misfortune
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Mastery, +278 Crit }, gems: { +100 Mastery }, enchant: { +150 Int }
Local Main Hand Scythe of Elune
ilevel: 850, weapon: { 3354 - 5033, 3.6 }, stats: { +1297 Int, +1945 Sta, +664 Crit, +637 Mastery, +7075 Int }, relics: { +29 ilevels, +40 ilevels, +31 ilevels }

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Kaptah"
origin="https://eu.api.battle.net/wow/character/hyjal/Kaptah/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/204/115079884-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=spell
position=back
professions=engineering=716/alchemy=777
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!2112202
artifact=59:0:0:0:0:1035:3:1036:2:1040:3:1044:1:1047:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=cowl_of_fright,id=139205,bonus_id=1807/43/1477/3336
neck=krakentooth_necklace,id=141473,bonus_id=1477/3336,enchant=75mastery
shoulders=charskin_mantle,id=137510,bonus_id=1727/1497/3336
back=drape_of_vile_misfortune,id=137530,bonus_id=1727/1808/1492/1813,gems=100mastery,enchant=150int
chest=felbat_leather_vest,id=134373,bonus_id=1727/42/1502/1813
shirt=darnassus_doublet,id=45670
wrists=biornskin_bracer,id=134192,bonus_id=3397/1492/1675
hands=grips_of_silent_screams,id=140996,bonus_id=3443/1477/1813
waist=dreadleather_belt,id=128890,bonus_id=689/1700/3408/600/669,addon=nitro_boosts
legs=dreadhide_leggings,id=121294,bonus_id=3432/1507/3336
feet=shadow_stalker_boots,id=136739,bonus_id=1727/1507/3336
finger1=shadowruby_band,id=136713,bonus_id=3354/689/600/669,gems=100mastery,enchant=150mastery
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1502/3336,enchant=150mastery
trinket1=nightmare_bloom,id=121311,bonus_id=3396/1808/605/1487/1675,gems=100mastery
trinket2=naraxas_spiked_tongue,id=137349,bonus_id=1727/1492/1813
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=133115/136720/136691/0,relic_id=1792:1738:1621:1809/1727:1492:1813/0/0

# Gear Summary
# gear_ilvl=845.67
# gear_stamina=18738
# gear_intellect=18398
# gear_crit_rating=5276
# gear_haste_rating=2003
# gear_mastery_rating=9009
# gear_versatility_rating=2202
# gear_speed_rating=539
# gear_armor=1994

Rinotor

Rinotor : 242778 dps

  • Race: Worgen
  • Class: Hunter
  • Spec: Beast Mastery
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
242777.9 242777.9 111.7 / 0.046% 22316.9 / 9.2% 5700.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.9 13.9 Focus 37.60% 32.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced
Talents
  • 15: Way of the Cobra (Beast Mastery Hunter)
  • 30: Stomp (Beast Mastery Hunter)
  • 45: Posthaste
  • 60: Bestial Fury (Beast Mastery Hunter)
  • 75: Intimidation (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact
Professions
  • blacksmithing: 700
  • jewelcrafting: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rinotor 242778
A Murder of Crows 0 (20391) 0.0% (8.4%) 8.0 60.44sec 1150142 866437

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 125.24 0.00 1.3275 0.9363 0.00 0.00 0.00 71734.86 866436.53
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 20391 8.4% 0.0 0.00sec 0 0 Direct 125.2 57963 116825 73230 25.9%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 125.24 0.00 0.00 0.0000 0.0000 9171230.67 13482577.81 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.75 74.06% 57963.05 49117 68764 57988.13 53545 62290 5376221 7903554 31.98
crit 32.48 25.94% 116824.84 98234 137528 116885.09 101257 130979 3795010 5579024 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 11290 4.7% 175.9 2.57sec 28905 11278 Direct 175.9 22952 46270 28905 25.5%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.88 175.88 0.00 0.00 2.5630 0.0000 5083814.39 7473688.71 31.98 11277.82 11277.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.97 74.47% 22951.64 19735 27628 22956.22 22163 23985 3006028 4419146 31.98
crit 44.91 25.53% 46270.21 39469 55257 46270.41 42100 50804 2077786 3054543 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cobra Shot 25900 10.7% 81.5 5.51sec 143129 111392 Direct 81.3 112978 227910 143434 26.5%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.48 81.31 0.00 0.00 1.2849 0.0000 11662655.86 17145208.83 31.98 111392.24 111392.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.76 73.50% 112977.81 83704 149513 113011.95 106489 120095 6751790 9925770 31.98
crit 21.55 26.50% 227910.31 167408 299026 228001.43 195447 255384 4910866 7219438 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Deadly Grace 7620 3.1% 26.8 3.43sec 125908 0 Direct 26.8 98593 200599 125905 26.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.84 26.84 0.00 0.00 0.0000 0.0000 3378831.98 3378831.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.65 73.22% 98593.00 82346 115284 98494.47 87413 109472 1937359 1937359 0.00
crit 7.19 26.78% 200598.63 164692 230568 200296.66 0 230568 1441473 1441473 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dire Beast 0 (35600) 0.0% (14.7%) 47.2 9.61sec 339519 302830

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.21 0.00 0.00 0.00 1.1212 0.0000 0.00 0.00 0.00 302830.09 302830.09
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 22423 7.2% 239.8 1.88sec 32896 19227 Direct 239.8 26194 52388 32895 25.6%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 239.77 239.77 0.00 0.00 1.7109 0.0000 7887257.54 11595015.68 31.98 19227.04 19227.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.42 74.41% 26193.84 26194 26194 26193.84 26194 26194 4673565 6870584 31.98
crit 61.34 25.59% 52387.67 52388 52388 52387.67 52388 52388 3213692 4724432 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stomp (dire_beast) 23140 7.5% 47.2 9.61sec 172456 0 Direct 47.2 137526 275052 172459 25.4%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.21 47.21 0.00 0.00 0.0000 0.0000 8141841.70 11969278.52 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.22 74.60% 137525.95 137526 137526 137525.95 137526 137526 4843695 7120690 31.98
crit 11.99 25.40% 275051.90 275052 275052 275051.90 275052 275052 3298147 4848589 31.98
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When your Dire Beasts charge in, they will stomp the ground, dealing ${($76657m1/100+1)*({$201754s1=1}*1.15)} Physical damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (78840) 0.0% (32.5%) 92.1 4.89sec 385142 346205

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 0.00 0.00 0.00 1.1125 0.0000 0.00 0.00 0.00 346205.48 346205.48
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 50378 20.8% 92.1 4.89sec 246085 0 Direct 92.1 176574 358902 246083 38.1%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 92.14 0.00 0.00 0.0000 0.0000 22675019.94 33334427.15 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.01 61.88% 176573.91 143255 200557 176581.88 166175 187533 10067282 14799859 31.98
crit 35.13 38.12% 358902.25 286509 401113 358976.30 324711 392624 12607737 18534568 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 10057 4.1% 36.8 12.13sec 123074 0 Direct 36.8 123071 0 123071 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.78 36.78 0.00 0.00 0.0000 0.0000 4527227.73 4527227.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.78 100.00% 123071.27 71627 200557 123088.38 94707 154357 4527228 4527228 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71627.35
  • base_dd_max:71627.35
 
    Kill Command (hati) 15341 6.3% 92.1 4.89sec 74951 0 Direct 92.1 59068 119319 74951 26.4%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 92.14 0.00 0.00 0.0000 0.0000 6906240.49 10152827.70 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.85 73.64% 59067.50 47752 66852 59072.55 56366 62167 4007860 5891934 31.98
crit 24.29 26.36% 119319.24 95503 133704 119339.07 105053 131582 2898380 4260893 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 3065 1.3% 36.8 12.17sec 37452 0 Direct 36.8 37453 0 37453 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.84 36.84 0.00 0.00 0.0000 0.0000 1379650.94 1379650.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.84 100.00% 37453.04 23876 66852 37457.39 29646 47752 1379651 1379651 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:23875.78
  • base_dd_max:23875.78
 
Mark of the Hidden Satyr 3760 1.5% 24.7 18.04sec 68414 0 Direct 24.7 54337 109469 68411 25.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.75 24.75 0.00 0.00 0.0000 0.0000 1693050.19 1693050.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.43 74.47% 54337.13 46803 65525 54334.62 46803 63554 1001379 1001379 0.00
crit 6.32 25.53% 109469.08 93607 131049 109185.40 0 131049 691671 691671 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:41625.00
  • base_dd_max:48375.00
 
Rancid Maw 10465 4.3% 19.8 22.57sec 238221 0 Direct 19.7 189749 383269 239033 25.5%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.78 19.71 0.00 0.00 0.0000 0.0000 4712196.62 4712196.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 74.53% 189748.76 163593 229031 189724.45 163593 222487 2787662 2787662 0.00
crit 5.02 25.47% 383268.52 327187 458062 380962.55 0 458062 1924535 1924535 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:149425.50
  • base_dd_max:165154.50
 
pet - cat 92364 / 92364
Claw 16056 6.6% 150.7 3.00sec 47991 47777 Direct 150.7 34743 71061 47992 36.5%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.69 150.69 0.00 0.00 1.0045 0.0000 7231803.74 10631436.52 31.98 47776.62 47776.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.72 63.52% 34742.59 16675 46690 34751.44 32197 37162 3325462 4888744 31.98
crit 54.97 36.48% 71060.50 33350 93381 71094.58 61526 79300 3906342 5742693 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 15874 6.5% 287.8 1.56sec 24838 15893 Direct 287.8 18074 36605 24838 36.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 287.79 287.79 0.00 0.00 1.5629 0.0000 7148102.61 10508387.92 31.98 15892.55 15892.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.75 63.50% 18074.16 15592 21829 18076.86 17399 18711 3303085 4855847 31.98
crit 105.04 36.50% 36605.24 31185 43659 36613.54 34543 38616 3845018 5652541 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 35387 / 35387
hati_melee 16981 7.0% 261.5 1.72sec 29242 17004 Direct 262.5 23137 46644 29131 25.5%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 261.49 262.49 0.00 0.00 1.7198 0.0000 7646616.23 11241250.16 31.98 17003.67 17003.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 195.56 74.50% 23136.87 19635 27892 23140.08 22391 24040 4524732 6651785 31.98
crit 66.93 25.50% 46643.57 39269 55783 46655.06 43423 50220 3121884 4589465 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Rinotor
Aspect of the Wild 4.0 127.30sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.04 0.00 50.73 0.00 0.0000 0.7846 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
Bestial Wrath 12.4 37.71sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.40 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rinotor
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 4.0 0.0 127.3sec 127.3sec 8.84% 4.44% 39.8(39.8) 3.9

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 12.4 0.0 37.7sec 37.7sec 40.64% 50.42% 0.0(0.0) 12.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • bestial_wrath_1:40.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.82% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 47.2 0.0 10.3sec 9.6sec 77.95% 72.30% 0.0(0.0) 39.8

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:72.90%
  • dire_beast_2:4.92%
  • dire_beast_3:0.13%
  • dire_beast_4:0.00%
  • dire_beast_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 13.08% 13.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:13.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
cat: Aspect of the Wild 4.0 0.0 127.3sec 127.3sec 8.84% 10.12% 39.8(39.8) 3.9

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:8.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 12.4 0.0 37.7sec 37.7sec 40.64% 42.91% 0.0(0.0) 12.0

Buff details

  • buff initial source:Rinotor_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • bestial_wrath_1:40.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 12.4 0.0 37.7sec 37.7sec 40.64% 43.90% 0.0(0.0) 12.0

Buff details

  • buff initial source:Rinotor_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • bestial_wrath_1:40.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use {$?s217200=false}[Dire Frenzy][Dire Beast].
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Rinotor
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rinotor
a_murder_of_crows Focus 8.0 239.2 30.0 30.0 38338.0
cobra_shot Focus 81.5 3259.3 40.0 40.0 3578.2
kill_command Focus 92.1 2764.3 30.0 30.0 12838.2
pet - cat
claw Focus 150.7 6810.0 45.2 45.2 1061.9
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1668.36 548.59 (8.87%) 0.33 0.47 0.09%
aspect_of_the_wild Focus 100.79 397.49 (6.43%) 3.94 1.00 0.25%
focus_regen Focus 2270.97 5238.73 (84.70%) 2.31 1.59 0.03%
pet - cat
focus_regen Focus 835.53 6408.04 (95.19%) 7.67 138.56 2.12%
aspect_of_the_wild Focus 84.53 323.69 (4.81%) 3.83 74.80 18.77%
Resource RPS-Gain RPS-Loss
Focus 13.73 13.90
Combat End Resource Mean Min Max
Focus 62.95 0.01 140.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 80.8%
Uptimes %
Focus Cap 0.0%
cat-Focus Cap 1.0%

Procs

Count Interval
starved: a_murder_of_crows 9.7 10.8sec
wild_call 9.0 45.3sec

Statistics & Data Analysis

Fight Length
Sample Data Rinotor Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Rinotor Damage Per Second
Count 9999
Mean 242777.89
Minimum 223155.29
Maximum 265078.37
Spread ( max - min ) 41923.08
Range [ ( max - min ) / 2 * 100% ] 8.63%
Standard Deviation 5699.2975
5th Percentile 233859.45
95th Percentile 252440.03
( 95th Percentile - 5th Percentile ) 18580.59
Mean Distribution
Standard Deviation 56.9958
95.00% Confidence Intervall ( 242666.18 - 242889.60 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2116
0.1 Scale Factor Error with Delta=300 277284
0.05 Scale Factor Error with Delta=300 1109139
0.01 Scale Factor Error with Delta=300 27728496
Priority Target DPS
Sample Data Rinotor Priority Target Damage Per Second
Count 9999
Mean 242777.89
Minimum 223155.29
Maximum 265078.37
Spread ( max - min ) 41923.08
Range [ ( max - min ) / 2 * 100% ] 8.63%
Standard Deviation 5699.2975
5th Percentile 233859.45
95th Percentile 252440.03
( 95th Percentile - 5th Percentile ) 18580.59
Mean Distribution
Standard Deviation 56.9958
95.00% Confidence Intervall ( 242666.18 - 242889.60 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2116
0.1 Scale Factor Error with Delta=300 277284
0.05 Scale Factor Error with Delta=300 1109139
0.01 Scale Factor Error with Delta=300 27728496
DPS(e)
Sample Data Rinotor Damage Per Second (Effective)
Count 9999
Mean 242777.89
Minimum 223155.29
Maximum 265078.37
Spread ( max - min ) 41923.08
Range [ ( max - min ) / 2 * 100% ] 8.63%
Damage
Sample Data Rinotor Damage
Count 9999
Mean 35701779.71
Minimum 26354677.25
Maximum 45886246.56
Spread ( max - min ) 19531569.31
Range [ ( max - min ) / 2 * 100% ] 27.35%
DTPS
Sample Data Rinotor Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rinotor Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rinotor Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rinotor Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rinotor Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rinotor Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RinotorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rinotor Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
7 1.00 potion,name=deadly_grace
8 7.98 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 47.22 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
A 4.04 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
0.00 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
B 12.40 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
C 92.15 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
0.00 chimaera_shot,if=focus<90
D 81.48 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

0124568B9ACDCDCDCDC9DCDC99CDC9BDCDCDC9DCDC9CD9C78DC9BDCDCDC9DC9CDC9DCD9BCDCDCD9C8AC9D9CDDDC9BDCDCDC9DC9CDC9DCD8C9BDCDCD9CDC9CDC9DCD9BCDCDCDC9DA8C9DCDDC9DCD9BCDCDCDC9DC9C9DCD89BCDCDC9CDC9C9DCD9BDCDCDC9DCC989CDDC9BADCDCDCDC9DC9CD9CDDC9BDCDCDC98C9C9DDCD9BCDC

Sample Sequence Table

time name target resources buffs
Pre flask Rinotor 140.0/140: 100% focus
Pre food Rinotor 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Rinotor 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:01.328 bestial_wrath Fluffy_Pillow 129.2/140: 92% focus bloodlust, potion_of_deadly_grace
0:01.328 dire_beast Fluffy_Pillow 129.2/140: 92% focus bloodlust, bestial_wrath, potion_of_deadly_grace
0:02.083 aspect_of_the_wild Fluffy_Pillow 140.0/140: 100% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.083 kill_command Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.837 cobra_shot Fluffy_Pillow 129.8/140: 93% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:03.860 kill_command Fluffy_Pillow 116.6/140: 83% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:04.615 cobra_shot Fluffy_Pillow 106.4/140: 76% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:05.637 kill_command Fluffy_Pillow 93.2/140: 67% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:06.391 cobra_shot Fluffy_Pillow 83.0/140: 59% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:07.414 kill_command Fluffy_Pillow 69.8/140: 50% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:08.168 cobra_shot Fluffy_Pillow 59.6/140: 43% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:09.190 kill_command Fluffy_Pillow 46.4/140: 33% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:09.945 dire_beast Fluffy_Pillow 35.1/140: 25% focus bloodlust, aspect_of_the_wild, bestial_wrath, potion_of_deadly_grace
0:10.698 cobra_shot Fluffy_Pillow 54.8/140: 39% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:11.722 kill_command Fluffy_Pillow 41.7/140: 30% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:12.475 Waiting 0.800 sec 27.5/140: 20% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:13.275 cobra_shot Fluffy_Pillow 40.5/140: 29% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:14.297 Waiting 0.800 sec 17.1/140: 12% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:15.097 kill_command Fluffy_Pillow 30.1/140: 21% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:15.852 Waiting 2.000 sec 12.3/140: 9% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:17.852 dire_beast Fluffy_Pillow 44.8/140: 32% focus bloodlust, dire_beast, potion_of_deadly_grace
0:18.845 Waiting 0.500 sec 60.5/140: 43% focus bloodlust, dire_beast, potion_of_deadly_grace
0:19.345 dire_beast Fluffy_Pillow 68.6/140: 49% focus bloodlust, dire_beast, potion_of_deadly_grace
0:20.100 kill_command Fluffy_Pillow 82.0/140: 59% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:20.944 Waiting 3.000 sec 67.0/140: 48% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:23.944 cobra_shot Fluffy_Pillow 120.2/140: 86% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:24.966 Waiting 0.100 sec 98.3/140: 70% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:25.066 kill_command Fluffy_Pillow 100.1/140: 71% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:26.035 Waiting 1.300 sec 87.3/140: 62% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:27.335 dire_beast Fluffy_Pillow 108.4/140: 77% focus bloodlust, dire_beast, potion_of_deadly_grace
0:28.246 bestial_wrath Fluffy_Pillow 122.9/140: 88% focus bloodlust, dire_beast
0:28.246 cobra_shot Fluffy_Pillow 122.9/140: 88% focus bloodlust, bestial_wrath, dire_beast
0:29.269 kill_command Fluffy_Pillow 99.5/140: 71% focus bloodlust, bestial_wrath, dire_beast
0:30.025 cobra_shot Fluffy_Pillow 81.8/140: 58% focus bloodlust, bestial_wrath, dire_beast
0:31.048 kill_command Fluffy_Pillow 58.4/140: 42% focus bloodlust, bestial_wrath, dire_beast
0:31.803 cobra_shot Fluffy_Pillow 40.6/140: 29% focus bloodlust, bestial_wrath, dire_beast
0:32.826 Waiting 0.800 sec 17.2/140: 12% focus bloodlust, bestial_wrath, dire_beast
0:33.626 kill_command Fluffy_Pillow 30.2/140: 22% focus bloodlust, bestial_wrath, dire_beast
0:34.381 Waiting 1.100 sec 12.5/140: 9% focus bloodlust, bestial_wrath, dire_beast
0:35.481 dire_beast Fluffy_Pillow 30.3/140: 22% focus bloodlust, bestial_wrath, dire_beast
0:36.394 cobra_shot Fluffy_Pillow 44.9/140: 32% focus bloodlust, bestial_wrath, dire_beast
0:37.417 Waiting 0.600 sec 21.5/140: 15% focus bloodlust, bestial_wrath, dire_beast
0:38.017 kill_command Fluffy_Pillow 31.2/140: 22% focus bloodlust, bestial_wrath, dire_beast
0:38.772 Waiting 1.700 sec 13.5/140: 10% focus bloodlust, bestial_wrath, dire_beast
0:40.472 cobra_shot Fluffy_Pillow 41.1/140: 29% focus bloodlust, bestial_wrath, dire_beast
0:41.494 Waiting 1.300 sec 14.2/140: 10% focus bestial_wrath, dire_beast
0:42.794 kill_command Fluffy_Pillow 30.9/140: 22% focus bestial_wrath, dire_beast
0:43.966 Waiting 0.500 sec 14.1/140: 10% focus
0:44.466 dire_beast Fluffy_Pillow 19.8/140: 14% focus
0:45.792 Waiting 3.400 sec 36.6/140: 26% focus dire_beast
0:49.192 kill_command Fluffy_Pillow 80.2/140: 57% focus dire_beast
0:50.585 Waiting 4.300 sec 68.1/140: 49% focus dire_beast
0:54.885 cobra_shot Fluffy_Pillow 119.8/140: 86% focus
0:56.212 dire_beast Fluffy_Pillow 94.8/140: 68% focus
0:57.385 kill_command Fluffy_Pillow 109.9/140: 78% focus dire_beast
0:58.556 potion Fluffy_Pillow 94.9/140: 68% focus dire_beast
0:58.556 Waiting 1.200 sec 94.9/140: 68% focus dire_beast, potion_of_deadly_grace
0:59.756 a_murder_of_crows Fluffy_Pillow 110.3/140: 79% focus dire_beast, potion_of_deadly_grace
1:01.329 Waiting 1.500 sec 100.5/140: 72% focus dire_beast, potion_of_deadly_grace
1:02.829 cobra_shot Fluffy_Pillow 119.7/140: 86% focus dire_beast, potion_of_deadly_grace
1:04.157 kill_command Fluffy_Pillow 96.8/140: 69% focus dire_beast, potion_of_deadly_grace
1:05.329 Waiting 1.300 sec 80.0/140: 57% focus potion_of_deadly_grace
1:06.629 dire_beast Fluffy_Pillow 94.8/140: 68% focus potion_of_deadly_grace
1:07.975 bestial_wrath Fluffy_Pillow 111.8/140: 80% focus dire_beast, potion_of_deadly_grace
1:07.975 cobra_shot Fluffy_Pillow 111.8/140: 80% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:09.304 kill_command Fluffy_Pillow 88.8/140: 63% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:10.474 cobra_shot Fluffy_Pillow 73.8/140: 53% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.802 kill_command Fluffy_Pillow 50.9/140: 36% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:12.973 Waiting 0.400 sec 35.9/140: 26% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:13.373 cobra_shot Fluffy_Pillow 41.0/140: 29% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:14.702 Waiting 1.100 sec 18.1/140: 13% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:15.802 kill_command Fluffy_Pillow 30.7/140: 22% focus bestial_wrath, potion_of_deadly_grace
1:16.973 Waiting 0.200 sec 14.0/140: 10% focus bestial_wrath, potion_of_deadly_grace
1:17.173 dire_beast Fluffy_Pillow 16.2/140: 12% focus bestial_wrath, potion_of_deadly_grace
1:18.568 Waiting 0.500 sec 33.8/140: 24% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:19.068 cobra_shot Fluffy_Pillow 40.2/140: 29% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:20.397 Waiting 1.000 sec 17.3/140: 12% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:21.397 kill_command Fluffy_Pillow 30.1/140: 22% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:22.569 Waiting 1.800 sec 15.1/140: 11% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:24.369 dire_beast Fluffy_Pillow 38.2/140: 27% focus dire_beast, potion_of_deadly_grace
1:25.540 Waiting 2.300 sec 53.3/140: 38% focus dire_beast, potion_of_deadly_grace
1:27.840 kill_command Fluffy_Pillow 82.8/140: 59% focus dire_beast, potion_of_deadly_grace
1:29.188 Waiting 3.900 sec 70.1/140: 50% focus dire_beast
1:33.088 cobra_shot Fluffy_Pillow 119.0/140: 85% focus
1:34.416 kill_command Fluffy_Pillow 94.1/140: 67% focus
1:35.806 dire_beast Fluffy_Pillow 79.8/140: 57% focus
1:36.976 Waiting 1.900 sec 94.9/140: 68% focus dire_beast
1:38.876 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
1:40.203 Waiting 0.900 sec 96.3/140: 69% focus dire_beast
1:41.103 kill_command Fluffy_Pillow 107.8/140: 77% focus dire_beast
1:42.425 Waiting 2.000 sec 94.8/140: 68% focus dire_beast
1:44.425 cobra_shot Fluffy_Pillow 119.5/140: 85% focus
1:45.752 Waiting 0.400 sec 94.6/140: 68% focus
1:46.152 dire_beast Fluffy_Pillow 99.1/140: 71% focus
1:47.569 bestial_wrath Fluffy_Pillow 116.9/140: 83% focus dire_beast
1:47.569 Waiting 0.100 sec 116.9/140: 83% focus bestial_wrath, dire_beast
1:47.669 kill_command Fluffy_Pillow 118.2/140: 84% focus bestial_wrath, dire_beast
1:49.044 cobra_shot Fluffy_Pillow 105.8/140: 76% focus bestial_wrath, dire_beast
1:50.372 kill_command Fluffy_Pillow 82.9/140: 59% focus bestial_wrath, dire_beast
1:51.543 cobra_shot Fluffy_Pillow 67.9/140: 48% focus bestial_wrath, dire_beast
1:52.869 kill_command Fluffy_Pillow 44.9/140: 32% focus bestial_wrath, dire_beast
1:54.042 Waiting 0.900 sec 29.9/140: 21% focus bestial_wrath, dire_beast
1:54.942 cobra_shot Fluffy_Pillow 40.6/140: 29% focus bestial_wrath
1:56.268 Waiting 0.500 sec 15.6/140: 11% focus bestial_wrath
1:56.768 dire_beast Fluffy_Pillow 21.3/140: 15% focus bestial_wrath
1:58.160 kill_command Fluffy_Pillow 38.8/140: 28% focus bestial_wrath, dire_beast
1:59.333 Waiting 0.500 sec 23.9/140: 17% focus bestial_wrath, dire_beast
1:59.833 a_murder_of_crows Fluffy_Pillow 30.3/140: 22% focus bestial_wrath, dire_beast
2:01.327 Waiting 0.600 sec 19.4/140: 14% focus bestial_wrath, dire_beast
2:01.927 aspect_of_the_wild Fluffy_Pillow 27.1/140: 19% focus bestial_wrath, dire_beast
2:02.083 Waiting 2.500 sec 29.1/140: 21% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:04.583 kill_command Fluffy_Pillow 86.2/140: 62% focus aspect_of_the_wild, dire_beast
2:05.951 Waiting 1.400 sec 86.0/140: 61% focus aspect_of_the_wild
2:07.351 dire_beast Fluffy_Pillow 115.9/140: 83% focus aspect_of_the_wild
2:08.751 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, dire_beast
2:10.079 dire_beast Fluffy_Pillow 130.3/140: 93% focus aspect_of_the_wild, dire_beast
2:11.250 kill_command Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, dire_beast(2)
2:12.568 cobra_shot Fluffy_Pillow 133.6/140: 95% focus dire_beast(2)
2:13.895 Waiting 0.500 sec 112.6/140: 80% focus dire_beast(2)
2:14.395 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast(2)
2:15.723 Waiting 1.700 sec 97.7/140: 70% focus dire_beast
2:17.423 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast
2:18.751 kill_command Fluffy_Pillow 94.6/140: 68% focus
2:19.922 Waiting 0.500 sec 77.9/140: 56% focus
2:20.422 dire_beast Fluffy_Pillow 83.5/140: 60% focus
2:21.841 bestial_wrath Fluffy_Pillow 101.4/140: 72% focus dire_beast
2:21.841 cobra_shot Fluffy_Pillow 101.4/140: 72% focus bestial_wrath, dire_beast
2:23.169 kill_command Fluffy_Pillow 78.4/140: 56% focus bestial_wrath, dire_beast
2:24.341 cobra_shot Fluffy_Pillow 63.4/140: 45% focus bestial_wrath, dire_beast
2:25.668 kill_command Fluffy_Pillow 40.5/140: 29% focus bestial_wrath, dire_beast
2:26.839 Waiting 1.200 sec 25.5/140: 18% focus bestial_wrath, dire_beast
2:28.039 cobra_shot Fluffy_Pillow 40.9/140: 29% focus bestial_wrath, dire_beast
2:29.365 Waiting 1.300 sec 15.9/140: 11% focus bestial_wrath
2:30.665 kill_command Fluffy_Pillow 30.6/140: 22% focus bestial_wrath
2:31.837 dire_beast Fluffy_Pillow 13.9/140: 10% focus bestial_wrath
2:33.010 Waiting 0.900 sec 29.0/140: 21% focus bestial_wrath, dire_beast
2:33.910 cobra_shot Fluffy_Pillow 40.5/140: 29% focus bestial_wrath, dire_beast
2:35.238 Waiting 1.000 sec 17.5/140: 13% focus bestial_wrath, dire_beast
2:36.238 kill_command Fluffy_Pillow 30.4/140: 22% focus bestial_wrath, dire_beast
2:37.409 Waiting 4.800 sec 15.4/140: 11% focus dire_beast
2:42.209 dire_beast Fluffy_Pillow 73.4/140: 52% focus
2:43.601 kill_command Fluffy_Pillow 90.9/140: 65% focus dire_beast
2:44.772 Waiting 3.400 sec 75.9/140: 54% focus dire_beast
2:48.172 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast
2:49.500 Waiting 0.500 sec 96.6/140: 69% focus dire_beast
2:50.000 kill_command Fluffy_Pillow 103.0/140: 74% focus dire_beast
2:51.392 Waiting 1.400 sec 89.1/140: 64% focus
2:52.792 dire_beast Fluffy_Pillow 105.0/140: 75% focus
2:54.192 cobra_shot Fluffy_Pillow 122.6/140: 88% focus dire_beast
2:55.520 Waiting 1.100 sec 99.6/140: 71% focus dire_beast
2:56.620 kill_command Fluffy_Pillow 113.7/140: 81% focus dire_beast
2:58.007 Waiting 1.400 sec 101.5/140: 73% focus dire_beast
2:59.407 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast
3:00.735 a_murder_of_crows Fluffy_Pillow 96.5/140: 69% focus dire_beast
3:02.063 Waiting 1.200 sec 81.6/140: 58% focus
3:03.263 kill_command Fluffy_Pillow 95.2/140: 68% focus
3:04.630 dire_beast Fluffy_Pillow 80.7/140: 58% focus
3:05.801 bestial_wrath Fluffy_Pillow 95.7/140: 68% focus dire_beast
3:05.801 cobra_shot Fluffy_Pillow 95.7/140: 68% focus bestial_wrath, dire_beast
3:07.130 kill_command Fluffy_Pillow 72.7/140: 52% focus bestial_wrath, dire_beast
3:08.301 cobra_shot Fluffy_Pillow 57.8/140: 41% focus bestial_wrath, dire_beast
3:09.630 kill_command Fluffy_Pillow 34.8/140: 25% focus bestial_wrath, dire_beast
3:10.801 Waiting 1.600 sec 19.8/140: 14% focus bestial_wrath, dire_beast
3:12.401 cobra_shot Fluffy_Pillow 40.4/140: 29% focus bestial_wrath, dire_beast
3:13.728 Waiting 1.300 sec 15.4/140: 11% focus bestial_wrath
3:15.028 dire_beast Fluffy_Pillow 30.1/140: 22% focus bestial_wrath
3:16.393 kill_command Fluffy_Pillow 47.4/140: 34% focus bestial_wrath, dire_beast
3:17.565 Waiting 0.600 sec 32.4/140: 23% focus bestial_wrath, dire_beast
3:18.165 cobra_shot Fluffy_Pillow 40.1/140: 29% focus bestial_wrath, dire_beast
3:19.493 Waiting 1.100 sec 17.1/140: 12% focus bestial_wrath, dire_beast
3:20.593 kill_command Fluffy_Pillow 31.2/140: 22% focus bestial_wrath, dire_beast
3:21.766 Waiting 3.800 sec 16.3/140: 12% focus dire_beast
3:25.566 dire_beast Fluffy_Pillow 61.5/140: 44% focus
3:26.984 kill_command Fluffy_Pillow 79.3/140: 57% focus dire_beast
3:28.384 Waiting 4.100 sec 67.2/140: 48% focus dire_beast
3:32.484 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast
3:33.811 kill_command Fluffy_Pillow 96.9/140: 69% focus dire_beast
3:35.003 Waiting 1.200 sec 80.4/140: 57% focus
3:36.203 dire_beast Fluffy_Pillow 94.0/140: 67% focus
3:37.575 Waiting 0.700 sec 111.3/140: 79% focus dire_beast
3:38.275 cobra_shot Fluffy_Pillow 120.3/140: 86% focus dire_beast
3:39.601 Waiting 0.600 sec 97.3/140: 69% focus dire_beast
3:40.201 kill_command Fluffy_Pillow 105.0/140: 75% focus dire_beast
3:41.623 Waiting 2.100 sec 93.2/140: 67% focus dire_beast
3:43.723 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast
3:45.051 Waiting 1.700 sec 95.2/140: 68% focus
3:46.751 dire_beast Fluffy_Pillow 114.5/140: 82% focus
3:48.164 bestial_wrath Fluffy_Pillow 132.2/140: 94% focus dire_beast
3:48.164 kill_command Fluffy_Pillow 132.2/140: 94% focus bestial_wrath, dire_beast
3:49.336 cobra_shot Fluffy_Pillow 117.3/140: 84% focus bestial_wrath, dire_beast
3:50.662 kill_command Fluffy_Pillow 94.3/140: 67% focus bestial_wrath, dire_beast
3:51.835 cobra_shot Fluffy_Pillow 79.3/140: 57% focus bestial_wrath, dire_beast
3:53.163 kill_command Fluffy_Pillow 56.4/140: 40% focus bestial_wrath, dire_beast
3:54.336 cobra_shot Fluffy_Pillow 41.4/140: 30% focus bestial_wrath, dire_beast
3:55.665 Waiting 1.200 sec 16.5/140: 12% focus bestial_wrath
3:56.865 kill_command Fluffy_Pillow 30.1/140: 21% focus bestial_wrath
3:58.037 dire_beast Fluffy_Pillow 13.4/140: 10% focus bestial_wrath
3:59.208 Waiting 1.000 sec 28.4/140: 20% focus bestial_wrath, dire_beast
4:00.208 cobra_shot Fluffy_Pillow 41.2/140: 29% focus bestial_wrath, dire_beast
4:01.533 Waiting 0.300 sec 18.2/140: 13% focus bestial_wrath, dire_beast
4:01.833 aspect_of_the_wild Fluffy_Pillow 22.1/140: 16% focus bestial_wrath, dire_beast
4:02.083 Waiting 0.300 sec 25.3/140: 18% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:02.383 a_murder_of_crows Fluffy_Pillow 32.1/140: 23% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:03.710 kill_command Fluffy_Pillow 32.4/140: 23% focus aspect_of_the_wild, dire_beast
4:04.881 Waiting 3.500 sec 29.2/140: 21% focus aspect_of_the_wild, dire_beast
4:08.381 dire_beast Fluffy_Pillow 105.5/140: 75% focus aspect_of_the_wild
4:09.798 cobra_shot Fluffy_Pillow 137.4/140: 98% focus aspect_of_the_wild, dire_beast
4:11.124 kill_command Fluffy_Pillow 127.7/140: 91% focus aspect_of_the_wild, dire_beast
4:12.295 cobra_shot Fluffy_Pillow 122.3/140: 87% focus dire_beast
4:13.622 Waiting 1.600 sec 99.3/140: 71% focus dire_beast
4:15.222 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast
4:16.551 Waiting 1.000 sec 96.9/140: 69% focus dire_beast
4:17.551 kill_command Fluffy_Pillow 108.4/140: 77% focus
4:18.915 Waiting 0.100 sec 93.9/140: 67% focus
4:19.015 dire_beast Fluffy_Pillow 95.0/140: 68% focus
4:20.392 Waiting 0.600 sec 112.4/140: 80% focus dire_beast
4:20.992 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
4:22.319 Waiting 1.800 sec 97.1/140: 69% focus dire_beast
4:24.119 kill_command Fluffy_Pillow 120.2/140: 86% focus dire_beast
4:25.535 Waiting 0.900 sec 108.3/140: 77% focus dire_beast
4:26.435 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast
4:27.763 Waiting 1.800 sec 95.7/140: 68% focus
4:29.563 dire_beast Fluffy_Pillow 116.1/140: 83% focus
4:30.983 bestial_wrath Fluffy_Pillow 133.9/140: 96% focus dire_beast
4:30.983 kill_command Fluffy_Pillow 133.9/140: 96% focus bestial_wrath, dire_beast
4:32.154 cobra_shot Fluffy_Pillow 118.9/140: 85% focus bestial_wrath, dire_beast
4:33.483 kill_command Fluffy_Pillow 96.0/140: 69% focus bestial_wrath, dire_beast
4:34.654 cobra_shot Fluffy_Pillow 81.0/140: 58% focus bestial_wrath, dire_beast
4:35.981 kill_command Fluffy_Pillow 58.0/140: 41% focus bestial_wrath, dire_beast
4:37.153 cobra_shot Fluffy_Pillow 43.1/140: 31% focus bestial_wrath, dire_beast
4:38.481 Waiting 1.100 sec 18.7/140: 13% focus bestial_wrath
4:39.581 kill_command Fluffy_Pillow 31.1/140: 22% focus bestial_wrath
4:40.752 dire_beast Fluffy_Pillow 14.4/140: 10% focus bestial_wrath
4:41.925 Waiting 0.900 sec 29.4/140: 21% focus bestial_wrath, dire_beast
4:42.825 cobra_shot Fluffy_Pillow 41.0/140: 29% focus bestial_wrath, dire_beast
4:44.153 Waiting 1.000 sec 18.0/140: 13% focus bestial_wrath, dire_beast
4:45.153 kill_command Fluffy_Pillow 30.9/140: 22% focus bestial_wrath, dire_beast
4:46.325 Waiting 4.800 sec 15.9/140: 11% focus dire_beast
4:51.125 dire_beast Fluffy_Pillow 73.9/140: 53% focus
4:52.516 kill_command Fluffy_Pillow 91.4/140: 65% focus dire_beast
4:53.686 dire_beast Fluffy_Pillow 76.4/140: 55% focus dire_beast
4:54.858 Waiting 1.900 sec 93.2/140: 67% focus dire_beast(2)
4:56.758 cobra_shot Fluffy_Pillow 120.4/140: 86% focus dire_beast(2)
4:58.087 Waiting 0.800 sec 99.5/140: 71% focus dire_beast(2)
4:58.887 kill_command Fluffy_Pillow 110.9/140: 79% focus dire_beast(2)
5:00.306 Waiting 1.600 sec 99.5/140: 71% focus dire_beast
5:01.906 cobra_shot Fluffy_Pillow 119.7/140: 86% focus
5:03.236 a_murder_of_crows Fluffy_Pillow 94.8/140: 68% focus
5:04.562 dire_beast Fluffy_Pillow 79.8/140: 57% focus
5:05.733 bestial_wrath Fluffy_Pillow 94.9/140: 68% focus dire_beast
5:05.733 kill_command Fluffy_Pillow 94.9/140: 68% focus bestial_wrath, dire_beast
5:06.925 cobra_shot Fluffy_Pillow 80.2/140: 57% focus bestial_wrath, dire_beast
5:08.252 kill_command Fluffy_Pillow 57.2/140: 41% focus bestial_wrath, dire_beast
5:09.423 cobra_shot Fluffy_Pillow 42.2/140: 30% focus bestial_wrath, dire_beast
5:10.750 Waiting 0.900 sec 19.2/140: 14% focus bestial_wrath, dire_beast
5:11.650 kill_command Fluffy_Pillow 30.8/140: 22% focus bestial_wrath, dire_beast
5:12.822 Waiting 2.100 sec 14.9/140: 11% focus bestial_wrath
5:14.922 dire_beast Fluffy_Pillow 38.7/140: 28% focus bestial_wrath
5:16.324 Waiting 1.700 sec 56.4/140: 40% focus bestial_wrath, dire_beast
5:18.024 kill_command Fluffy_Pillow 78.2/140: 56% focus bestial_wrath, dire_beast
5:19.440 cobra_shot Fluffy_Pillow 66.3/140: 47% focus bestial_wrath, dire_beast
5:20.766 kill_command Fluffy_Pillow 43.4/140: 31% focus dire_beast
5:21.938 Waiting 0.600 sec 28.4/140: 20% focus dire_beast
5:22.538 dire_beast Fluffy_Pillow 36.1/140: 26% focus dire_beast
5:23.711 Waiting 3.500 sec 51.1/140: 37% focus dire_beast
5:27.211 kill_command Fluffy_Pillow 96.0/140: 69% focus dire_beast
5:28.558 dire_beast Fluffy_Pillow 83.3/140: 60% focus dire_beast
5:29.731 Waiting 1.400 sec 100.1/140: 72% focus dire_beast(2)
5:31.131 cobra_shot Fluffy_Pillow 119.3/140: 85% focus dire_beast
5:32.457 Waiting 1.300 sec 96.3/140: 69% focus dire_beast
5:33.757 kill_command Fluffy_Pillow 113.0/140: 81% focus dire_beast
5:35.175 Waiting 1.400 sec 101.2/140: 72% focus dire_beast
5:36.575 cobra_shot Fluffy_Pillow 119.1/140: 85% focus dire_beast
5:37.904 Waiting 0.500 sec 94.2/140: 67% focus
5:38.404 dire_beast Fluffy_Pillow 99.9/140: 71% focus
5:39.575 bestial_wrath Fluffy_Pillow 114.9/140: 82% focus dire_beast
5:39.575 Waiting 0.400 sec 114.9/140: 82% focus bestial_wrath, dire_beast
5:39.975 cobra_shot Fluffy_Pillow 120.0/140: 86% focus bestial_wrath, dire_beast
5:41.302 kill_command Fluffy_Pillow 97.0/140: 69% focus bestial_wrath, dire_beast
5:42.473 cobra_shot Fluffy_Pillow 82.1/140: 59% focus bestial_wrath, dire_beast
5:43.798 kill_command Fluffy_Pillow 59.1/140: 42% focus bestial_wrath, dire_beast
5:44.970 cobra_shot Fluffy_Pillow 44.1/140: 32% focus bestial_wrath, dire_beast
5:46.297 Waiting 0.800 sec 21.1/140: 15% focus bestial_wrath, dire_beast
5:47.097 kill_command Fluffy_Pillow 30.3/140: 22% focus bestial_wrath
5:48.268 Waiting 0.500 sec 13.6/140: 10% focus bestial_wrath
5:48.768 dire_beast Fluffy_Pillow 19.3/140: 14% focus bestial_wrath
5:50.168 Waiting 0.300 sec 36.9/140: 26% focus bestial_wrath, dire_beast
5:50.468 cobra_shot Fluffy_Pillow 40.7/140: 29% focus bestial_wrath, dire_beast
5:51.796 Waiting 1.000 sec 17.8/140: 13% focus bestial_wrath, dire_beast
5:52.796 kill_command Fluffy_Pillow 30.6/140: 22% focus bestial_wrath, dire_beast
5:53.969 Waiting 5.200 sec 15.7/140: 11% focus bestial_wrath, dire_beast
5:59.169 kill_command Fluffy_Pillow 79.1/140: 56% focus
6:00.589 dire_beast Fluffy_Pillow 65.2/140: 47% focus
6:01.761 Waiting 1.300 sec 80.2/140: 57% focus dire_beast
6:03.061 a_murder_of_crows Fluffy_Pillow 96.9/140: 69% focus dire_beast
6:04.563 Waiting 0.400 sec 86.2/140: 62% focus dire_beast
6:04.963 dire_beast Fluffy_Pillow 91.3/140: 65% focus dire_beast
6:06.136 kill_command Fluffy_Pillow 108.1/140: 77% focus dire_beast(2)
6:07.309 Waiting 1.800 sec 94.9/140: 68% focus dire_beast(2)
6:09.109 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast
6:10.440 Waiting 1.800 sec 97.0/140: 69% focus dire_beast
6:12.240 cobra_shot Fluffy_Pillow 120.1/140: 86% focus dire_beast
6:13.567 kill_command Fluffy_Pillow 96.0/140: 69% focus
6:14.738 Waiting 0.600 sec 79.3/140: 57% focus
6:15.338 dire_beast Fluffy_Pillow 86.1/140: 61% focus
6:16.724 bestial_wrath Fluffy_Pillow 103.5/140: 74% focus dire_beast
6:16.724 aspect_of_the_wild Fluffy_Pillow 103.5/140: 74% focus bestial_wrath, dire_beast
6:16.724 cobra_shot Fluffy_Pillow 103.5/140: 74% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:18.050 kill_command Fluffy_Pillow 93.8/140: 67% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:19.220 cobra_shot Fluffy_Pillow 90.5/140: 65% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:20.549 kill_command Fluffy_Pillow 80.9/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:21.722 cobra_shot Fluffy_Pillow 77.6/140: 55% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:23.051 kill_command Fluffy_Pillow 68.0/140: 49% focus aspect_of_the_wild, bestial_wrath, dire_beast
6:24.222 cobra_shot Fluffy_Pillow 63.5/140: 45% focus aspect_of_the_wild, bestial_wrath
6:25.550 kill_command Fluffy_Pillow 51.8/140: 37% focus aspect_of_the_wild, bestial_wrath
6:26.721 dire_beast Fluffy_Pillow 46.8/140: 33% focus aspect_of_the_wild, bestial_wrath
6:27.893 cobra_shot Fluffy_Pillow 61.8/140: 44% focus bestial_wrath, dire_beast
6:29.223 kill_command Fluffy_Pillow 38.9/140: 28% focus bestial_wrath, dire_beast
6:30.395 Waiting 1.000 sec 23.9/140: 17% focus bestial_wrath, dire_beast
6:31.395 dire_beast Fluffy_Pillow 36.8/140: 26% focus bestial_wrath, dire_beast
6:32.566 Waiting 3.100 sec 53.5/140: 38% focus dire_beast(2)
6:35.666 kill_command Fluffy_Pillow 96.5/140: 69% focus dire_beast
6:37.015 Waiting 2.800 sec 83.8/140: 60% focus dire_beast
6:39.815 cobra_shot Fluffy_Pillow 119.1/140: 85% focus
6:41.141 Waiting 0.600 sec 94.1/140: 67% focus
6:41.741 dire_beast Fluffy_Pillow 100.9/140: 72% focus
6:43.159 kill_command Fluffy_Pillow 118.7/140: 85% focus dire_beast
6:44.331 Waiting 1.200 sec 103.8/140: 74% focus dire_beast
6:45.531 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
6:46.861 Waiting 1.800 sec 96.2/140: 69% focus dire_beast
6:48.661 cobra_shot Fluffy_Pillow 119.3/140: 85% focus dire_beast
6:49.989 kill_command Fluffy_Pillow 96.4/140: 69% focus dire_beast
6:51.160 Waiting 1.200 sec 79.6/140: 57% focus
6:52.360 dire_beast Fluffy_Pillow 93.2/140: 67% focus
6:53.747 bestial_wrath Fluffy_Pillow 110.7/140: 79% focus dire_beast
6:53.747 cobra_shot Fluffy_Pillow 110.7/140: 79% focus bestial_wrath, dire_beast
6:55.075 kill_command Fluffy_Pillow 87.7/140: 63% focus bestial_wrath, dire_beast
6:56.246 cobra_shot Fluffy_Pillow 72.8/140: 52% focus bestial_wrath, dire_beast
6:57.573 kill_command Fluffy_Pillow 49.8/140: 36% focus bestial_wrath, dire_beast
6:58.744 Waiting 0.500 sec 34.8/140: 25% focus bestial_wrath, dire_beast
6:59.244 cobra_shot Fluffy_Pillow 41.2/140: 29% focus bestial_wrath, dire_beast
7:00.571 Waiting 1.100 sec 18.3/140: 13% focus bestial_wrath, dire_beast
7:01.671 kill_command Fluffy_Pillow 30.7/140: 22% focus bestial_wrath
7:02.841 Waiting 0.100 sec 14.0/140: 10% focus bestial_wrath
7:02.941 dire_beast Fluffy_Pillow 15.1/140: 11% focus bestial_wrath
7:04.340 a_murder_of_crows Fluffy_Pillow 32.7/140: 23% focus bestial_wrath, dire_beast
7:05.666 Waiting 2.400 sec 19.7/140: 14% focus bestial_wrath, dire_beast
7:08.066 kill_command Fluffy_Pillow 50.5/140: 36% focus bestial_wrath, dire_beast
7:09.461 Waiting 4.100 sec 38.4/140: 27% focus dire_beast
7:13.561 dire_beast Fluffy_Pillow 87.4/140: 62% focus
7:14.932 kill_command Fluffy_Pillow 104.7/140: 75% focus dire_beast
7:16.104 Waiting 0.300 sec 89.8/140: 64% focus dire_beast
7:16.404 dire_beast Fluffy_Pillow 93.6/140: 67% focus dire_beast
7:17.575 Waiting 0.700 sec 110.4/140: 79% focus dire_beast(2)
7:18.275 cobra_shot Fluffy_Pillow 120.4/140: 86% focus dire_beast(2)
7:19.603 Waiting 1.400 sec 99.4/140: 71% focus dire_beast(2)
7:21.003 cobra_shot Fluffy_Pillow 119.5/140: 85% focus dire_beast(2)
7:22.329 kill_command Fluffy_Pillow 97.5/140: 70% focus dire_beast
7:23.501 Waiting 3.200 sec 82.5/140: 59% focus dire_beast
7:26.701 cobra_shot Fluffy_Pillow 120.1/140: 86% focus
7:28.028 dire_beast Fluffy_Pillow 95.1/140: 68% focus
7:29.199 bestial_wrath Fluffy_Pillow 110.2/140: 79% focus dire_beast
7:29.199 kill_command Fluffy_Pillow 110.2/140: 79% focus bestial_wrath, dire_beast
7:30.371 cobra_shot Fluffy_Pillow 95.2/140: 68% focus bestial_wrath, dire_beast
7:31.698 kill_command Fluffy_Pillow 72.2/140: 52% focus bestial_wrath, dire_beast

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 23250 21885 11812 (9065)
Stamina 29664 29664 18722
Intellect 6002 6002 0
Spirit -1 -1 0
Health 1779840 1779840 0
Focus 140 140 0
Crit 24.63% 24.63% 3021
Haste 13.30% 13.30% 4322
Damage / Heal Versatility 4.01% 4.01% 1603
Attack Power 23250 21885 0
Mastery 81.65% 79.25% 9527
Armor 2491 2491 2491
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Sea Stalker's Hood
ilevel: 850, stats: { 336 Armor, +1297 AgiInt, +1945 Sta, +904 Mastery, +400 Vers }
Local Neck Nightborne's Jeweled Necklace
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +200 Agi }
Local Chest Tideskorn Vest
ilevel: 845, stats: { 407 Armor, +1238 AgiInt, +1857 Sta, +869 Crit, +412 Mastery }
Local Waist Creeping String of Larva
ilevel: 850, stats: { 233 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Ley Dragoon's Legguards
ilevel: 840, stats: { 351 Armor, +1182 AgiInt, +1773 Sta, +899 Mastery, +359 Haste }, gems: { +150 Mastery }
Local Feet Manaburst Greaves
ilevel: 850, stats: { 284 Armor, +973 AgiInt, +1459 Sta, +678 Mastery, +301 Crit }
Local Wrists Blighted Grasp Bracers
ilevel: 840, stats: { 175 Armor, +665 AgiInt, +997 Sta, +444 Vers, +263 Haste }, gems: { +150 Mastery }
Local Hands Gauntlets of Malevolent Intent
ilevel: 860, stats: { 267 Armor, +1601 Sta, +1068 AgiInt, +617 Haste, +399 Vers }
Local Finger1 Band of Fused Coral
ilevel: 840, stats: { +997 Sta, +1263 Haste, +505 Crit }, gems: { +150 Mastery }, enchant: { +50 Mastery }
Local Finger2 Signet of the Highborne Magi
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Crit }, enchant: { +50 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 840, stats: { +898 Mastery }
Local Trinket2 Three-Toed Rabbit Foot
ilevel: 840, stats: { +1123 Agi, +898 Mastery }, gems: { +150 Mastery }
Local Back Cape of Valarjar Courage
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +360 Mastery, +360 Vers }, enchant: { +100 Mastery }
Local Main Hand Titanstrike
ilevel: 860, weapon: { 7672 - 7674, 3 }, stats: { +1424 Agi, +2136 Sta, +689 Crit, +661 Mastery }, relics: { +36 ilevels, +37 ilevels, +37 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Dash
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Rinotor"
origin="https://eu.api.battle.net/wow/character/hyjal/Rinotor/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/211/115093459-avatar.jpg"
level=110
race=worgen
role=attack
position=ranged_back
professions=jewelcrafting=700/blacksmithing=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ya!1001201
artifact=56:0:0:0:0:869:2:871:2:872:3:873:3:874:3:875:3:877:1:878:1:881:1:1336:1
spec=beast_mastery

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=sea_stalkers_hood,id=134255,bonus_id=1727/1512/3336
neck=nightbornes_jeweled_necklace,id=134275,bonus_id=3397/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=200agi
back=cape_of_valarjar_courage,id=133765,bonus_id=1727/1497/3336,enchant=gift_of_mastery
chest=tideskorn_vest,id=134214,bonus_id=1727/1507/3336
wrists=blighted_grasp_bracers,id=137305,bonus_id=1727/1808/1492/1813,gems=150mastery
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1807/1482/3336
waist=creeping_string_of_larva,id=139212,bonus_id=1807/1472
legs=ley_dragoons_legguards,id=134300,bonus_id=3397/1808/1502/3336,gems=150mastery
feet=manaburst_greaves,id=134342,bonus_id=3397/1512/3337
finger1=band_of_fused_coral,id=134532,bonus_id=1726/1808/1492/3337,gems=150mastery,enchant=50mastery
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1492/1813,enchant=50mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=1727/1492/1813
trinket2=threetoed_rabbit_foot,id=134203,bonus_id=3397/1808/605/1502/3336,gems=150mastery
main_hand=titanstrike,id=128861,bonus_id=726,gem_id=137365/141266/141262/0,relic_id=1726:1477/3397:1492:1675/3397:1492:1675/0

# Gear Summary
# gear_ilvl=846.00
# gear_agility=11812
# gear_stamina=18722
# gear_crit_rating=3021
# gear_haste_rating=4322
# gear_mastery_rating=9527
# gear_versatility_rating=1603
# gear_armor=2491
summon_pet=cat

Ptitchu

Ptitchu : 227833 dps

  • Race: Night Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
227832.6 227832.6 126.8 / 0.056% 25440.9 / 11.2% 10336.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
19.8 19.8 Focus 4.29% 37.2 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ptitchu/advanced
Talents
  • 15: Steady Focus (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • tailoring: 755
  • enchanting: 737

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Ptitchu 227833
Aimed Shot 102142 44.8% 148.7 3.02sec 309054 200306 Direct 148.6 205818 470455 309320 39.1%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.72 148.59 0.00 0.00 1.5429 0.0000 45961528.15 67567799.98 31.98 200305.63 200305.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.48 60.89% 205817.80 205818 205818 205817.80 205818 205818 18621931 27376003 31.98
crit 58.11 39.11% 470454.67 432217 658617 470689.08 436189 514107 27339597 40191797 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lock_and_load.up&debuff.vulnerability.remains>gcd.max
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.15
 
auto_shot 10562 4.6% 170.8 2.64sec 27837 10576 Direct 170.8 20106 43397 27837 33.2%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.76 170.76 0.00 0.00 2.6321 0.0000 4753432.54 6987996.09 31.98 10576.09 10576.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.07 66.80% 20105.75 20106 20106 20105.75 20106 20106 2293499 3371661 31.98
crit 56.69 33.20% 43396.51 40212 60317 43419.43 40212 47567 2459933 3616335 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 28016 12.3% 21.2 21.79sec 594595 219005 Periodic 338.4 27351 57337 37266 33.1% 11.6%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.21 0.00 338.36 338.36 2.7150 0.1544 12609241.15 18536778.87 31.98 219005.49 219005.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 226.5 66.94% 27351.20 27351 27351 27351.20 27351 27351 6194603 9106653 31.98
crit 111.9 33.06% 57336.54 54702 82054 57405.85 54702 62432 6414638 9430126 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 9384 4.1% 32.7 13.07sec 128223 0 Direct 32.7 79886 199012 128229 40.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.70 32.70 0.00 0.00 0.0000 0.0000 4193116.91 4193116.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.43 59.42% 79885.56 79886 79886 79885.56 79886 79886 1552316 1552316 0.00
crit 13.27 40.58% 199012.50 159771 239657 198456.75 159771 239657 2640801 2640801 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 26594 11.7% 38.6 11.58sec 310073 254478 Direct 38.6 224466 482375 310072 33.2%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.60 38.60 0.00 0.00 1.2185 0.0000 11970124.15 17597216.35 31.98 254477.74 254477.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.79 66.81% 224465.95 94020 235049 224443.24 179864 235049 5788934 8510281 31.98
crit 12.81 33.19% 482374.53 188040 705148 482833.89 319667 705148 6181190 9086935 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.react<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=25}%.$?a190529[ Aimed Shot critical strike chance increased by {$s3=0}%.][] Lasts $6d. Stacks up to {$u=3} times.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Sidewinders 11475 5.0% 46.2 9.73sec 111759 91945 Direct 46.2 81072 174168 111758 33.0%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.22 46.22 0.00 0.00 1.2155 0.0000 5165097.61 5165097.61 0.00 91944.92 91944.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.98 67.04% 81071.54 81072 81072 81071.54 81072 81072 2511734 2511734 0.00
crit 15.23 32.96% 174168.40 162143 243215 174263.80 162143 216191 2653364 2653364 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&debuff.hunters_mark.down&(buff.marking_targets.react|buff.trueshot.react|charges=2)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 16616 7.3% 19.1 22.80sec 391129 311922 Direct 20.1 273512 571937 372284 33.1%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.14 20.10 0.00 0.00 1.2540 0.0000 7484256.44 11002565.90 31.98 311922.00 311922.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.45 66.90% 273512.03 273512 273512 273512.03 273512 273512 3678585 5407868 31.98
crit 6.65 33.10% 571937.34 547024 820536 572079.72 0 820536 3805671 5594697 31.95
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
pet - cat 17174 / 17174
Claw 8799 3.9% 150.7 3.00sec 26310 26193 Direct 150.7 18382 36765 26310 43.1%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.69 150.69 0.00 0.00 1.0045 0.0000 3964682.50 5828458.83 31.98 26192.52 26192.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.70 56.87% 18382.38 18382 18382 18382.38 18382 18382 1575377 2315954 31.98
crit 64.99 43.13% 36764.77 36765 36765 36764.77 36765 36765 2389305 3512505 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 8374 3.7% 306.4 1.47sec 12304 8382 Direct 306.4 8594 17189 12304 43.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 306.41 306.41 0.00 0.00 1.4680 0.0000 3770113.92 5542424.58 31.98 8381.66 8381.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.14 56.83% 8594.36 8594 8594 8594.36 8594 8594 1496659 2200231 31.98
crit 132.26 43.17% 17188.72 17189 17189 17188.72 17189 17189 2273455 3342194 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - spawn_of_serpentrix 22050 / 5870
Magma Spit 22050 2.6% 92.7 4.26sec 28507 19004 Direct 92.4 21473 42945 28612 33.2%  

Stats details: magma_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.72 92.38 0.00 0.00 1.5000 0.0000 2643064.53 2643064.53 0.00 19004.46 19004.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.66 66.75% 21472.53 21473 21473 21472.53 21473 21473 1324017 1324017 0.00
crit 30.71 33.25% 42945.06 42945 42945 42945.06 42945 42945 1319048 1319048 0.00
 
 

Action details: magma_spit

Static Values
  • id:215754
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215754
  • name:Magma Spit
  • school:fire
  • tooltip:
  • description:Spit a ball of magma that inflicts {$215745s1=13992} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21280.80
  • base_dd_max:21280.80
 
Simple Action Stats Execute Interval
Ptitchu
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitchu
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitchu
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitchu
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 3.0 209.41sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.react|target.health.pct>20+(cooldown.trueshot.remains+15))|buff.bullseye.react>25
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ace of Dominion 3.0 0.0 103.0sec 101.3sec 12.56% 12.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_ace_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:699.80

Stack Uptimes

  • ace_of_dominion_1:12.56%

Trigger Attempt Success

  • trigger_pct:95.45%

Spelldata details

  • id:191545
  • name:Ace of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=637}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.89% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 154.0 0.0sec 0.6sec 20.00% 20.06% 125.0(125.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.16%
  • bullseye_2:0.18%
  • bullseye_3:0.18%
  • bullseye_4:0.17%
  • bullseye_5:0.18%
  • bullseye_6:0.15%
  • bullseye_7:0.15%
  • bullseye_8:0.15%
  • bullseye_9:0.14%
  • bullseye_10:0.13%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.10%
  • bullseye_15:0.09%
  • bullseye_16:0.08%
  • bullseye_17:0.08%
  • bullseye_18:0.08%
  • bullseye_19:0.08%
  • bullseye_20:0.09%
  • bullseye_21:0.10%
  • bullseye_22:0.10%
  • bullseye_23:0.10%
  • bullseye_24:0.11%
  • bullseye_25:0.12%
  • bullseye_26:0.13%
  • bullseye_27:0.13%
  • bullseye_28:0.13%
  • bullseye_29:0.13%
  • bullseye_30:16.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Eight of Dominion 2.9 0.0 102.1sec 101.0sec 12.49% 12.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_eight_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1399.60

Stack Uptimes

  • eight_of_dominion_1:12.49%

Trigger Attempt Success

  • trigger_pct:94.99%

Spelldata details

  • id:191554
  • name:Eight of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=1275}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Five of Dominion 3.0 0.0 102.4sec 101.1sec 12.60% 12.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_five_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1050.07

Stack Uptimes

  • five_of_dominion_1:12.60%

Trigger Attempt Success

  • trigger_pct:95.17%

Spelldata details

  • id:191551
  • name:Five of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=956}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Four of Dominion 2.9 0.0 103.7sec 102.0sec 12.49% 12.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_four_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:963.07

Stack Uptimes

  • four_of_dominion_1:12.49%

Trigger Attempt Success

  • trigger_pct:95.17%

Spelldata details

  • id:191550
  • name:Four of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=877}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Lock and Load 13.5 0.2 31.7sec 31.2sec 5.71% 7.11% 0.2(0.2) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:3.13%
  • lock_and_load_2:2.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 38.7 12.9 11.7sec 8.7sec 36.83% 50.24% 12.9(12.9) 0.3

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:36.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 374.2sec 0.0sec 13.08% 13.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:13.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rapid Killing 3.0 0.0 194.7sec 209.3sec 9.86% 13.79% 0.0(0.0) 2.9

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Seven of Dominion 2.9 0.0 103.5sec 102.0sec 12.43% 12.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_seven_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1224.83

Stack Uptimes

  • seven_of_dominion_1:12.43%

Trigger Attempt Success

  • trigger_pct:95.33%

Spelldata details

  • id:191553
  • name:Seven of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=1116}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Six of Dominion 3.0 0.0 103.1sec 101.8sec 12.53% 12.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_six_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1137.83

Stack Uptimes

  • six_of_dominion_1:12.53%

Trigger Attempt Success

  • trigger_pct:95.36%

Spelldata details

  • id:191552
  • name:Six of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=1037}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Steady Focus 11.3 34.9 40.6sec 9.7sec 93.07% 89.34% 34.9(34.9) 10.3

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • steady_focus_1:93.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193534
  • name:Steady Focus
  • tooltip:Focus regeneration increased by $w1%.
  • description:{$@spelldesc193533=Using Arcane Shot or Multi-Shot three times in a row increases your Focus Regeneration by {$193534s1=25}% for {$193534d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Three of Dominion 2.9 0.0 102.8sec 101.5sec 12.46% 12.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_three_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:874.56

Stack Uptimes

  • three_of_dominion_1:12.46%

Trigger Attempt Success

  • trigger_pct:95.35%

Spelldata details

  • id:191549
  • name:Three of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=797}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 3.0 0.0 194.7sec 209.3sec 9.86% 12.57% 0.0(0.0) 2.9

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Two of Dominion 2.9 0.0 102.6sec 101.2sec 12.44% 12.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_two_of_dominion
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:788.31

Stack Uptimes

  • two_of_dominion_1:12.44%

Trigger Attempt Success

  • trigger_pct:95.08%

Spelldata details

  • id:191548
  • name:Two of Dominion
  • tooltip:Critical strike rating increased by $w1.
  • description:Increase critical strike rating by {$s1=718}.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ptitchu
aimed_shot Focus 148.7 6080.8 40.9 40.9 7558.4
barrage Focus 21.2 1272.4 60.0 60.0 9910.0
marked_shot Focus 38.6 1158.1 30.0 30.0 10335.7
windburst Focus 20.1 402.7 20.0 21.0 18585.2
pet - cat
claw Focus 150.7 7534.4 50.0 50.0 526.2
Resource Gains Type Count Total Average Overflow
sidewinders Focus 46.22 2268.89 (25.67%) 49.09 41.95 1.82%
focus_regen Focus 1170.75 5365.73 (60.70%) 4.58 213.04 3.82%
steady_focus Focus 1016.22 1204.80 (13.63%) 1.19 75.12 5.87%
pet - cat
focus_regen Focus 756.06 6318.41 (84.20%) 8.36 658.22 9.43%
steady_focus Focus 704.56 1186.01 (15.80%) 1.68 433.81 26.78%
Resource RPS-Gain RPS-Loss
Focus 19.62 19.78
Combat End Resource Mean Min Max
Focus 74.72 0.27 150.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 100.0%
Uptimes %
Focus Cap 2.8%
cat-Focus Cap 4.6%

Procs

Count Interval
starved: barrage 62.4 5.9sec
lock_and_load 13.7 31.2sec
no_vuln_aimed_shot 3.5 71.0sec
no_vuln_marked_shot 2.9 92.7sec
marking_targets 51.7 8.7sec
wasted_marking_targets 12.9 33.0sec

Statistics & Data Analysis

Fight Length
Sample Data Ptitchu Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Ptitchu Damage Per Second
Count 9999
Mean 227832.61
Minimum 205170.68
Maximum 252141.84
Spread ( max - min ) 46971.16
Range [ ( max - min ) / 2 * 100% ] 10.31%
Standard Deviation 6470.9084
5th Percentile 217536.22
95th Percentile 238927.87
( 95th Percentile - 5th Percentile ) 21391.65
Mean Distribution
Standard Deviation 64.7123
95.00% Confidence Intervall ( 227705.78 - 227959.45 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 3098
0.1 Scale Factor Error with Delta=300 357449
0.05 Scale Factor Error with Delta=300 1429796
0.01 Scale Factor Error with Delta=300 35744906
Priority Target DPS
Sample Data Ptitchu Priority Target Damage Per Second
Count 9999
Mean 227832.61
Minimum 205170.68
Maximum 252141.84
Spread ( max - min ) 46971.16
Range [ ( max - min ) / 2 * 100% ] 10.31%
Standard Deviation 6470.9084
5th Percentile 217536.22
95th Percentile 238927.87
( 95th Percentile - 5th Percentile ) 21391.65
Mean Distribution
Standard Deviation 64.7123
95.00% Confidence Intervall ( 227705.78 - 227959.45 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 3098
0.1 Scale Factor Error with Delta=300 357449
0.05 Scale Factor Error with Delta=300 1429796
0.01 Scale Factor Error with Delta=300 35744906
DPS(e)
Sample Data Ptitchu Damage Per Second (Effective)
Count 9999
Mean 227832.61
Minimum 205170.68
Maximum 252141.84
Spread ( max - min ) 46971.16
Range [ ( max - min ) / 2 * 100% ] 10.31%
Damage
Sample Data Ptitchu Damage
Count 9999
Mean 92136796.96
Minimum 66664593.63
Maximum 119038514.56
Spread ( max - min ) 52373920.93
Range [ ( max - min ) / 2 * 100% ] 28.42%
DTPS
Sample Data Ptitchu Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ptitchu Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ptitchu Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ptitchu Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ptitchu Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ptitchu Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PtitchuTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ptitchu Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
0.00 auto_shot
8 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows
9 21.21 barrage
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
A 4.90 windburst,if=active_enemies<2&buff.marking_targets.down&(debuff.vulnerability.down|debuff.vulnerability.remains<cast_time)
B 9.77 windburst,if=active_enemies<2&buff.marking_targets.down&focus+cast_regen>90
C 4.52 windburst,if=active_enemies<2&cooldown.sidewinders.charges=0
0.00 arcane_shot,if=!talent.patient_sniper.enabled&active_enemies=1&debuff.vulnerability.react<3&buff.marking_targets.react&debuff.hunters_mark.down
0.00 marked_shot,if=!talent.patient_sniper.enabled&debuff.vulnerability.react<3
0.00 marked_shot,if=prev_off_gcd.sentinel
0.00 sentinel,if=debuff.hunters_mark.down&buff.marking_targets.down
0.00 explosive_shot
0.00 marked_shot,if=active_enemies>=4&cooldown.sidewinders.charges_fractional>=0.8
0.00 sidewinders,if=active_enemies>1&debuff.hunters_mark.down&(buff.marking_targets.react|buff.trueshot.react|charges=2)
0.00 arcane_shot,if=talent.steady_focus.enabled&active_enemies=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&active_enemies>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 arcane_shot,if=talent.true_aim.enabled&active_enemies=1&(debuff.true_aim.react<1|debuff.true_aim.remains<2)
D 17.15 aimed_shot,if=buff.lock_and_load.up&debuff.vulnerability.remains>gcd.max
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 marked_shot,if=!talent.sidewinders.enabled&(debuff.vulnerability.remains<2|buff.marking_targets.react)
0.00 pool_resource,for_next=1,if=talent.sidewinders.enabled&(focus<60&cooldown.sidewinders.charges_fractional<=1.2)
E 132.01 aimed_shot,if=cast_time<debuff.vulnerability.remains&(focus+cast_regen>80|debuff.hunters_mark.down)
F 38.60 marked_shot
0.00 black_arrow
G 41.24 sidewinders,if=debuff.hunters_mark.down&(buff.marking_targets.remains>6|buff.trueshot.react|charges=2)
H 4.97 sidewinders,if=focus<30&charges<=1&recharge_time<=5
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 arcane_shot,if=focus.deficit<10
actions.cooldowns
# count action,conditions
I 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23
J 2.97 trueshot,if=(buff.bloodlust.react|target.health.pct>20+(cooldown.trueshot.remains+15))|buff.bullseye.react>25

Sample Sequence

0124567J9EEGEEEFGEEFGEEEEFGE9FEHBEEEGEEEFGE9FEGBEEEFDDE9GDEFEEGBDDEF9EEGEEFDDEGBE9FEGEEFDDEGEB9EFGEEGEEFEEG9BEEFHEE9GBEEEFGJEEEFGE9EFCGEEEFEHE9GECEEEFGEEFEG9BDDEFEGEEFEG9ECEFGEEFEG9FECDDDEGEEFEG9EFEGBEEEFG9EFEGECEEDFD9EGEEFEGBEEEFEH9EGDDCEEEFDDEG9IJEFEGBEEEFGEEEFG9EFGBEEEFGEEFE9AGEEFGEEFEG

Sample Sequence Table

time name target resources buffs
Pre flask Ptitchu 150.0/150: 100% focus
Pre food Ptitchu 150.0/150: 100% focus
Pre summon_pet Fluffy_Pillow 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Ptitchu 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.038 aimed_shot Fluffy_Pillow 108.2/150: 72% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.992 aimed_shot Fluffy_Pillow 78.3/150: 52% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.947 sidewinders Fluffy_Pillow 48.5/150: 32% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.704 aimed_shot Fluffy_Pillow 118.4/150: 79% focus bloodlust, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:05.656 aimed_shot Fluffy_Pillow 93.5/150: 62% focus bloodlust, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:06.609 aimed_shot Fluffy_Pillow 68.7/150: 46% focus bloodlust, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:07.561 marked_shot Fluffy_Pillow 43.8/150: 29% focus bloodlust, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:08.315 sidewinders Fluffy_Pillow 33.7/150: 22% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:09.068 aimed_shot Fluffy_Pillow 103.5/150: 69% focus bloodlust, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:10.020 aimed_shot Fluffy_Pillow 78.6/150: 52% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:10.973 marked_shot Fluffy_Pillow 53.8/150: 36% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:11.726 sidewinders Fluffy_Pillow 43.6/150: 29% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:12.480 aimed_shot Fluffy_Pillow 113.5/150: 76% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:13.432 aimed_shot Fluffy_Pillow 88.6/150: 59% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:14.386 aimed_shot Fluffy_Pillow 63.8/150: 43% focus bloodlust, marking_targets, rapid_killing, steady_focus, trueshot, potion_of_deadly_grace
0:16.357 aimed_shot Fluffy_Pillow 55.5/150: 37% focus bloodlust, marking_targets, steady_focus, two_of_dominion, potion_of_deadly_grace
0:17.688 marked_shot Fluffy_Pillow 30.6/150: 20% focus bloodlust, marking_targets, steady_focus, two_of_dominion, potion_of_deadly_grace
0:18.687 sidewinders Fluffy_Pillow 19.4/150: 13% focus bloodlust, marking_targets, steady_focus, two_of_dominion, potion_of_deadly_grace
0:19.687 aimed_shot Fluffy_Pillow 88.2/150: 59% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:21.020 barrage Fluffy_Pillow 63.3/150: 42% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:23.275 marked_shot Fluffy_Pillow 45.8/150: 31% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:24.275 Waiting 0.900 sec 34.7/150: 23% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:25.175 aimed_shot Fluffy_Pillow 51.6/150: 34% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:26.506 sidewinders Fluffy_Pillow 26.7/150: 18% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:27.505 windburst Fluffy_Pillow 95.5/150: 64% focus bloodlust, steady_focus, two_of_dominion, potion_of_deadly_grace
0:28.505 aimed_shot Fluffy_Pillow 94.3/150: 63% focus bloodlust, steady_focus, two_of_dominion
0:29.836 aimed_shot Fluffy_Pillow 69.4/150: 46% focus bloodlust, steady_focus, two_of_dominion
0:31.168 Waiting 0.300 sec 44.5/150: 30% focus bloodlust, steady_focus, two_of_dominion
0:31.468 aimed_shot Fluffy_Pillow 50.1/150: 33% focus bloodlust, steady_focus, two_of_dominion
0:32.800 sidewinders Fluffy_Pillow 25.2/150: 17% focus bloodlust, marking_targets, steady_focus, two_of_dominion
0:33.799 aimed_shot Fluffy_Pillow 94.0/150: 63% focus bloodlust, marking_targets, steady_focus, two_of_dominion
0:35.129 aimed_shot Fluffy_Pillow 69.1/150: 46% focus bloodlust, marking_targets, steady_focus, two_of_dominion
0:37.225 aimed_shot Fluffy_Pillow 58.6/150: 39% focus bloodlust, marking_targets, steady_focus, three_of_dominion
0:38.558 marked_shot Fluffy_Pillow 33.7/150: 22% focus bloodlust, marking_targets, steady_focus, three_of_dominion
0:39.556 sidewinders Fluffy_Pillow 22.5/150: 15% focus bloodlust, marking_targets, steady_focus, three_of_dominion
0:40.556 aimed_shot Fluffy_Pillow 91.3/150: 61% focus bloodlust, steady_focus, three_of_dominion
0:41.887 barrage Fluffy_Pillow 60.6/150: 40% focus steady_focus, three_of_dominion
0:44.765 marked_shot Fluffy_Pillow 42.3/150: 28% focus steady_focus, three_of_dominion
0:47.593 aimed_shot Fluffy_Pillow 53.3/150: 36% focus marking_targets, steady_focus, three_of_dominion
0:49.323 sidewinders Fluffy_Pillow 28.3/150: 19% focus marking_targets, steady_focus, three_of_dominion
0:50.622 windburst Fluffy_Pillow 97.2/150: 65% focus steady_focus, three_of_dominion
0:51.921 aimed_shot Fluffy_Pillow 96.0/150: 64% focus steady_focus, three_of_dominion
0:53.650 aimed_shot Fluffy_Pillow 71.0/150: 47% focus steady_focus, three_of_dominion
0:56.147 aimed_shot Fluffy_Pillow 57.2/150: 38% focus steady_focus, three_of_dominion
0:57.876 marked_shot Fluffy_Pillow 32.3/150: 22% focus steady_focus, three_of_dominion
0:59.174 aimed_shot Fluffy_Pillow 21.1/150: 14% focus lock_and_load(2), marking_targets, steady_focus, three_of_dominion
1:00.472 aimed_shot Fluffy_Pillow 39.9/150: 27% focus lock_and_load, marking_targets, steady_focus, three_of_dominion
1:01.771 aimed_shot Fluffy_Pillow 55.0/150: 37% focus marking_targets, three_of_dominion
1:03.500 barrage Fluffy_Pillow 75.1/150: 50% focus lock_and_load, marking_targets, three_of_dominion
1:06.389 sidewinders Fluffy_Pillow 48.6/150: 32% focus lock_and_load, marking_targets, three_of_dominion
1:07.687 aimed_shot Fluffy_Pillow 117.4/150: 78% focus lock_and_load, marking_targets, steady_focus, three_of_dominion
1:08.984 aimed_shot Fluffy_Pillow 136.2/150: 91% focus marking_targets, steady_focus, three_of_dominion
1:10.712 marked_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets, steady_focus, three_of_dominion
1:12.011 aimed_shot Fluffy_Pillow 88.9/150: 59% focus marking_targets, steady_focus, three_of_dominion
1:13.739 aimed_shot Fluffy_Pillow 63.9/150: 43% focus marking_targets, steady_focus, three_of_dominion
1:15.469 sidewinders Fluffy_Pillow 39.0/150: 26% focus marking_targets, steady_focus, three_of_dominion
1:16.767 windburst Fluffy_Pillow 107.8/150: 72% focus steady_focus, six_of_dominion
1:18.066 aimed_shot Fluffy_Pillow 106.6/150: 71% focus lock_and_load(2), steady_focus, six_of_dominion
1:19.364 aimed_shot Fluffy_Pillow 125.4/150: 84% focus lock_and_load, steady_focus, six_of_dominion
1:20.664 aimed_shot Fluffy_Pillow 144.2/150: 96% focus steady_focus, six_of_dominion
1:22.392 marked_shot Fluffy_Pillow 100.0/150: 67% focus steady_focus, six_of_dominion
1:23.690 barrage Fluffy_Pillow 88.9/150: 59% focus steady_focus, six_of_dominion
1:26.443 aimed_shot Fluffy_Pillow 68.7/150: 46% focus steady_focus, six_of_dominion
1:28.172 aimed_shot Fluffy_Pillow 89.8/150: 60% focus lock_and_load, marking_targets, six_of_dominion
1:29.469 sidewinders Fluffy_Pillow 104.8/150: 70% focus marking_targets, six_of_dominion
1:30.765 aimed_shot Fluffy_Pillow 150.0/150: 100% focus steady_focus, six_of_dominion
1:32.495 aimed_shot Fluffy_Pillow 100.1/150: 67% focus steady_focus, six_of_dominion
1:34.223 marked_shot Fluffy_Pillow 75.1/150: 50% focus steady_focus, six_of_dominion
1:35.521 aimed_shot Fluffy_Pillow 63.9/150: 43% focus lock_and_load(2), steady_focus, three_of_dominion
1:36.820 aimed_shot Fluffy_Pillow 82.7/150: 55% focus lock_and_load, steady_focus, three_of_dominion
1:38.117 aimed_shot Fluffy_Pillow 101.5/150: 68% focus marking_targets, steady_focus, three_of_dominion
1:39.848 sidewinders Fluffy_Pillow 76.6/150: 51% focus marking_targets, steady_focus, three_of_dominion
1:41.145 windburst Fluffy_Pillow 145.4/150: 97% focus steady_focus, three_of_dominion
1:42.444 aimed_shot Fluffy_Pillow 130.1/150: 87% focus steady_focus, three_of_dominion
1:44.173 barrage Fluffy_Pillow 100.1/150: 67% focus steady_focus, three_of_dominion
1:46.954 marked_shot Fluffy_Pillow 80.4/150: 54% focus steady_focus, three_of_dominion
1:48.253 aimed_shot Fluffy_Pillow 69.2/150: 46% focus steady_focus, three_of_dominion
1:49.983 sidewinders Fluffy_Pillow 44.2/150: 29% focus marking_targets, steady_focus, three_of_dominion
1:51.280 aimed_shot Fluffy_Pillow 113.0/150: 75% focus steady_focus, three_of_dominion
1:53.011 aimed_shot Fluffy_Pillow 88.1/150: 59% focus steady_focus, three_of_dominion
1:54.741 marked_shot Fluffy_Pillow 63.2/150: 42% focus steady_focus, three_of_dominion
1:56.039 aimed_shot Fluffy_Pillow 52.0/150: 35% focus lock_and_load(2), steady_focus, eight_of_dominion
1:57.338 aimed_shot Fluffy_Pillow 70.8/150: 47% focus lock_and_load, steady_focus, eight_of_dominion
1:58.637 aimed_shot Fluffy_Pillow 89.6/150: 60% focus marking_targets, steady_focus, eight_of_dominion
2:00.368 sidewinders Fluffy_Pillow 64.7/150: 43% focus marking_targets, steady_focus, eight_of_dominion
2:01.665 aimed_shot Fluffy_Pillow 133.5/150: 89% focus steady_focus, eight_of_dominion
2:03.393 windburst Fluffy_Pillow 100.0/150: 67% focus steady_focus, eight_of_dominion
2:04.690 barrage Fluffy_Pillow 98.8/150: 66% focus steady_focus, eight_of_dominion
2:07.500 aimed_shot Fluffy_Pillow 79.6/150: 53% focus steady_focus, eight_of_dominion
2:09.230 marked_shot Fluffy_Pillow 54.6/150: 36% focus steady_focus, eight_of_dominion
2:10.528 Waiting 0.400 sec 43.4/150: 29% focus steady_focus, eight_of_dominion
2:10.928 sidewinders Fluffy_Pillow 49.2/150: 33% focus steady_focus, eight_of_dominion
2:12.226 aimed_shot Fluffy_Pillow 118.0/150: 79% focus steady_focus, eight_of_dominion
2:13.954 aimed_shot Fluffy_Pillow 93.1/150: 62% focus steady_focus, eight_of_dominion
2:15.683 sidewinders Fluffy_Pillow 68.1/150: 45% focus marking_targets, steady_focus, two_of_dominion
2:16.981 aimed_shot Fluffy_Pillow 136.9/150: 91% focus steady_focus, two_of_dominion
2:18.711 aimed_shot Fluffy_Pillow 100.1/150: 67% focus steady_focus, two_of_dominion
2:20.441 marked_shot Fluffy_Pillow 75.1/150: 50% focus steady_focus, two_of_dominion
2:21.741 aimed_shot Fluffy_Pillow 64.0/150: 43% focus steady_focus, two_of_dominion
2:23.471 Waiting 0.800 sec 39.0/150: 26% focus steady_focus, two_of_dominion
2:24.271 aimed_shot Fluffy_Pillow 50.6/150: 34% focus steady_focus, two_of_dominion
2:25.999 sidewinders Fluffy_Pillow 25.7/150: 17% focus marking_targets, steady_focus, two_of_dominion
2:27.297 barrage Fluffy_Pillow 94.5/150: 63% focus steady_focus, two_of_dominion
2:30.135 windburst Fluffy_Pillow 75.6/150: 50% focus steady_focus, two_of_dominion
2:31.434 aimed_shot Fluffy_Pillow 74.4/150: 50% focus steady_focus, two_of_dominion
2:33.674 aimed_shot Fluffy_Pillow 56.9/150: 38% focus steady_focus, two_of_dominion
2:35.404 marked_shot Fluffy_Pillow 31.9/150: 21% focus steady_focus, two_of_dominion
2:36.703 Waiting 0.300 sec 20.8/150: 14% focus steady_focus, five_of_dominion
2:37.003 sidewinders Fluffy_Pillow 25.1/150: 17% focus steady_focus, five_of_dominion
2:38.301 aimed_shot Fluffy_Pillow 93.9/150: 63% focus steady_focus, five_of_dominion
2:40.030 aimed_shot Fluffy_Pillow 69.0/150: 46% focus steady_focus, five_of_dominion
2:41.760 Waiting 5.300 sec 44.0/150: 29% focus steady_focus, five_of_dominion
2:47.060 barrage Fluffy_Pillow 120.8/150: 81% focus steady_focus, five_of_dominion
2:50.069 Waiting 0.400 sec 100.9/150: 67% focus five_of_dominion
2:50.469 sidewinders Fluffy_Pillow 105.5/150: 70% focus marking_targets, five_of_dominion
2:51.768 windburst Fluffy_Pillow 150.0/150: 100% focus steady_focus, five_of_dominion
2:53.066 aimed_shot Fluffy_Pillow 130.1/150: 87% focus marking_targets, steady_focus, five_of_dominion
2:54.794 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets, steady_focus, five_of_dominion
2:56.524 aimed_shot Fluffy_Pillow 75.1/150: 50% focus marking_targets, steady_focus, two_of_dominion
2:58.253 marked_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets, steady_focus, two_of_dominion
2:59.552 sidewinders Fluffy_Pillow 39.0/150: 26% focus marking_targets, steady_focus, two_of_dominion
3:00.850 trueshot Fluffy_Pillow 107.8/150: 72% focus steady_focus, two_of_dominion
3:00.850 aimed_shot Fluffy_Pillow 107.8/150: 72% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:02.086 aimed_shot Fluffy_Pillow 82.9/150: 55% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:03.322 aimed_shot Fluffy_Pillow 57.9/150: 39% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:04.560 marked_shot Fluffy_Pillow 33.0/150: 22% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:05.487 sidewinders Fluffy_Pillow 21.9/150: 15% focus marking_targets, rapid_killing, steady_focus, trueshot, two_of_dominion
3:06.414 aimed_shot Fluffy_Pillow 90.7/150: 60% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:07.653 barrage Fluffy_Pillow 65.8/150: 44% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:10.236 aimed_shot Fluffy_Pillow 58.2/150: 39% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:11.472 marked_shot Fluffy_Pillow 33.3/150: 22% focus rapid_killing, steady_focus, trueshot, two_of_dominion
3:12.912 windburst Fluffy_Pillow 32.5/150: 22% focus marking_targets, rapid_killing, steady_focus, trueshot, two_of_dominion
3:14.755 sidewinders Fluffy_Pillow 49.9/150: 33% focus marking_targets, rapid_killing, steady_focus, trueshot, two_of_dominion
3:15.682 aimed_shot Fluffy_Pillow 118.7/150: 79% focus rapid_killing, steady_focus, trueshot, seven_of_dominion
3:16.917 aimed_shot Fluffy_Pillow 87.5/150: 58% focus steady_focus, seven_of_dominion
3:18.645 aimed_shot Fluffy_Pillow 62.6/150: 42% focus steady_focus, seven_of_dominion
3:20.375 marked_shot Fluffy_Pillow 37.6/150: 25% focus steady_focus, seven_of_dominion
3:21.928 Waiting 1.400 sec 30.1/150: 20% focus steady_focus, seven_of_dominion
3:23.328 aimed_shot Fluffy_Pillow 50.4/150: 34% focus steady_focus, seven_of_dominion
3:25.057 sidewinders Fluffy_Pillow 25.5/150: 17% focus steady_focus, seven_of_dominion
3:26.354 aimed_shot Fluffy_Pillow 94.3/150: 63% focus steady_focus, seven_of_dominion
3:28.084 barrage Fluffy_Pillow 69.3/150: 46% focus steady_focus, seven_of_dominion
3:30.907 Waiting 0.300 sec 50.2/150: 33% focus steady_focus, seven_of_dominion
3:31.207 sidewinders Fluffy_Pillow 54.6/150: 36% focus marking_targets, steady_focus, seven_of_dominion
3:32.507 aimed_shot Fluffy_Pillow 123.4/150: 82% focus steady_focus, seven_of_dominion
3:34.237 windburst Fluffy_Pillow 98.5/150: 66% focus marking_targets, steady_focus, seven_of_dominion
3:35.535 aimed_shot Fluffy_Pillow 97.3/150: 65% focus marking_targets, steady_focus, ace_of_dominion
3:37.264 aimed_shot Fluffy_Pillow 72.3/150: 48% focus marking_targets, steady_focus, ace_of_dominion
3:39.759 aimed_shot Fluffy_Pillow 58.5/150: 39% focus marking_targets, steady_focus, ace_of_dominion
3:41.489 marked_shot Fluffy_Pillow 33.6/150: 22% focus marking_targets, steady_focus, ace_of_dominion
3:42.788 sidewinders Fluffy_Pillow 22.4/150: 15% focus marking_targets, steady_focus, ace_of_dominion
3:44.086 aimed_shot Fluffy_Pillow 91.2/150: 61% focus steady_focus, ace_of_dominion
3:45.816 aimed_shot Fluffy_Pillow 66.2/150: 44% focus steady_focus, ace_of_dominion
3:47.545 marked_shot Fluffy_Pillow 41.3/150: 28% focus steady_focus, ace_of_dominion
3:50.378 aimed_shot Fluffy_Pillow 52.3/150: 35% focus marking_targets, steady_focus, ace_of_dominion
3:52.108 sidewinders Fluffy_Pillow 27.4/150: 18% focus marking_targets, steady_focus, ace_of_dominion
3:53.405 barrage Fluffy_Pillow 96.2/150: 64% focus steady_focus, ace_of_dominion
3:56.292 windburst Fluffy_Pillow 78.0/150: 52% focus steady_focus, eight_of_dominion
3:57.591 aimed_shot Fluffy_Pillow 76.9/150: 51% focus lock_and_load(2), steady_focus, eight_of_dominion
3:58.889 aimed_shot Fluffy_Pillow 95.7/150: 64% focus lock_and_load, steady_focus, eight_of_dominion
4:00.188 aimed_shot Fluffy_Pillow 114.5/150: 76% focus marking_targets, steady_focus, eight_of_dominion
4:01.918 marked_shot Fluffy_Pillow 89.6/150: 60% focus marking_targets, steady_focus, eight_of_dominion
4:03.216 aimed_shot Fluffy_Pillow 78.4/150: 52% focus marking_targets, steady_focus, eight_of_dominion
4:04.945 sidewinders Fluffy_Pillow 48.4/150: 32% focus marking_targets, eight_of_dominion
4:06.243 aimed_shot Fluffy_Pillow 117.2/150: 78% focus steady_focus, eight_of_dominion
4:07.972 aimed_shot Fluffy_Pillow 92.3/150: 62% focus marking_targets, steady_focus, eight_of_dominion
4:09.701 marked_shot Fluffy_Pillow 67.3/150: 45% focus marking_targets, steady_focus, eight_of_dominion
4:10.999 aimed_shot Fluffy_Pillow 56.1/150: 37% focus marking_targets, steady_focus, eight_of_dominion
4:12.727 sidewinders Fluffy_Pillow 31.2/150: 21% focus marking_targets, steady_focus, eight_of_dominion
4:14.026 barrage Fluffy_Pillow 100.0/150: 67% focus steady_focus, eight_of_dominion
4:16.913 aimed_shot Fluffy_Pillow 81.8/150: 55% focus steady_focus, six_of_dominion
4:18.643 windburst Fluffy_Pillow 56.9/150: 38% focus marking_targets, steady_focus, six_of_dominion
4:19.942 aimed_shot Fluffy_Pillow 55.7/150: 37% focus marking_targets, steady_focus, six_of_dominion
4:21.672 marked_shot Fluffy_Pillow 30.8/150: 21% focus marking_targets, steady_focus, six_of_dominion
4:22.971 sidewinders Fluffy_Pillow 19.6/150: 13% focus marking_targets, steady_focus, six_of_dominion
4:24.269 aimed_shot Fluffy_Pillow 88.4/150: 59% focus steady_focus, six_of_dominion
4:25.997 aimed_shot Fluffy_Pillow 63.4/150: 42% focus steady_focus, six_of_dominion
4:27.726 marked_shot Fluffy_Pillow 38.5/150: 26% focus steady_focus, six_of_dominion
4:30.815 aimed_shot Fluffy_Pillow 53.2/150: 35% focus steady_focus, six_of_dominion
4:32.544 Waiting 0.100 sec 28.3/150: 19% focus steady_focus, six_of_dominion
4:32.644 sidewinders Fluffy_Pillow 29.7/150: 20% focus marking_targets, steady_focus, six_of_dominion
4:33.942 barrage Fluffy_Pillow 98.5/150: 66% focus steady_focus, six_of_dominion
4:36.930 marked_shot Fluffy_Pillow 81.8/150: 55% focus steady_focus, six_of_dominion
4:38.229 aimed_shot Fluffy_Pillow 70.7/150: 47% focus marking_targets, steady_focus, six_of_dominion
4:39.960 windburst Fluffy_Pillow 95.7/150: 64% focus lock_and_load, marking_targets, steady_focus, six_of_dominion
4:41.258 aimed_shot Fluffy_Pillow 94.5/150: 63% focus lock_and_load, marking_targets, steady_focus, six_of_dominion
4:42.555 aimed_shot Fluffy_Pillow 113.3/150: 76% focus lock_and_load(2), marking_targets, steady_focus, six_of_dominion
4:43.855 aimed_shot Fluffy_Pillow 132.2/150: 88% focus lock_and_load, marking_targets, steady_focus, six_of_dominion
4:45.156 aimed_shot Fluffy_Pillow 147.3/150: 98% focus marking_targets, six_of_dominion
4:46.886 sidewinders Fluffy_Pillow 100.1/150: 67% focus marking_targets, six_of_dominion
4:48.185 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, steady_focus, six_of_dominion
4:49.916 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, steady_focus, six_of_dominion
4:51.646 marked_shot Fluffy_Pillow 75.2/150: 50% focus marking_targets, steady_focus, six_of_dominion
4:52.946 aimed_shot Fluffy_Pillow 64.0/150: 43% focus marking_targets, steady_focus, six_of_dominion
4:54.677 sidewinders Fluffy_Pillow 39.1/150: 26% focus marking_targets, steady_focus, six_of_dominion
4:55.977 barrage Fluffy_Pillow 107.9/150: 72% focus marking_targets, steady_focus, seven_of_dominion
4:58.847 aimed_shot Fluffy_Pillow 89.5/150: 60% focus marking_targets, steady_focus, seven_of_dominion
5:00.577 marked_shot Fluffy_Pillow 64.6/150: 43% focus marking_targets, steady_focus, seven_of_dominion
5:01.877 aimed_shot Fluffy_Pillow 53.4/150: 36% focus marking_targets, steady_focus, seven_of_dominion
5:03.606 sidewinders Fluffy_Pillow 28.4/150: 19% focus marking_targets, steady_focus, seven_of_dominion
5:04.905 windburst Fluffy_Pillow 97.3/150: 65% focus steady_focus, seven_of_dominion
5:06.201 aimed_shot Fluffy_Pillow 96.0/150: 64% focus steady_focus, seven_of_dominion
5:07.931 aimed_shot Fluffy_Pillow 71.1/150: 47% focus steady_focus, seven_of_dominion
5:10.426 aimed_shot Fluffy_Pillow 57.3/150: 38% focus steady_focus, seven_of_dominion
5:12.156 marked_shot Fluffy_Pillow 32.3/150: 22% focus steady_focus, seven_of_dominion
5:13.455 Waiting 1.200 sec 21.1/150: 14% focus steady_focus, seven_of_dominion
5:14.655 sidewinders Fluffy_Pillow 38.5/150: 26% focus marking_targets, steady_focus, seven_of_dominion
5:15.953 barrage Fluffy_Pillow 107.3/150: 72% focus steady_focus, four_of_dominion
5:18.735 aimed_shot Fluffy_Pillow 87.7/150: 58% focus steady_focus, four_of_dominion
5:20.463 marked_shot Fluffy_Pillow 62.7/150: 42% focus marking_targets, steady_focus, four_of_dominion
5:21.762 aimed_shot Fluffy_Pillow 51.5/150: 34% focus marking_targets, steady_focus, four_of_dominion
5:24.005 sidewinders Fluffy_Pillow 34.0/150: 23% focus marking_targets, steady_focus, four_of_dominion
5:25.303 aimed_shot Fluffy_Pillow 102.8/150: 69% focus marking_targets, steady_focus, four_of_dominion
5:27.033 windburst Fluffy_Pillow 77.9/150: 52% focus marking_targets, steady_focus, four_of_dominion
5:28.332 aimed_shot Fluffy_Pillow 76.7/150: 51% focus marking_targets, steady_focus, four_of_dominion
5:30.316 aimed_shot Fluffy_Pillow 55.5/150: 37% focus marking_targets, steady_focus, four_of_dominion
5:32.048 aimed_shot Fluffy_Pillow 80.5/150: 54% focus lock_and_load, marking_targets, steady_focus, four_of_dominion
5:33.346 marked_shot Fluffy_Pillow 99.4/150: 66% focus marking_targets, steady_focus, four_of_dominion
5:34.645 aimed_shot Fluffy_Pillow 88.2/150: 59% focus lock_and_load(2), marking_targets, steady_focus, four_of_dominion
5:35.944 barrage Fluffy_Pillow 107.0/150: 71% focus lock_and_load, marking_targets, steady_focus, two_of_dominion
5:38.930 aimed_shot Fluffy_Pillow 81.7/150: 54% focus lock_and_load, marking_targets, two_of_dominion
5:40.230 sidewinders Fluffy_Pillow 96.8/150: 65% focus marking_targets, two_of_dominion
5:41.529 aimed_shot Fluffy_Pillow 150.0/150: 100% focus steady_focus, two_of_dominion
5:43.259 aimed_shot Fluffy_Pillow 100.1/150: 67% focus steady_focus, two_of_dominion
5:44.989 marked_shot Fluffy_Pillow 75.1/150: 50% focus marking_targets, steady_focus, two_of_dominion
5:46.288 aimed_shot Fluffy_Pillow 64.0/150: 43% focus marking_targets, steady_focus, two_of_dominion
5:48.017 sidewinders Fluffy_Pillow 39.0/150: 26% focus marking_targets, steady_focus, two_of_dominion
5:49.314 windburst Fluffy_Pillow 107.8/150: 72% focus steady_focus, two_of_dominion
5:50.612 aimed_shot Fluffy_Pillow 106.6/150: 71% focus steady_focus, two_of_dominion
5:52.341 aimed_shot Fluffy_Pillow 81.7/150: 54% focus steady_focus, two_of_dominion
5:54.070 aimed_shot Fluffy_Pillow 56.7/150: 38% focus steady_focus, two_of_dominion
5:55.800 marked_shot Fluffy_Pillow 31.8/150: 21% focus steady_focus, two_of_dominion
5:57.097 Waiting 2.100 sec 20.6/150: 14% focus steady_focus, two_of_dominion
5:59.197 aimed_shot Fluffy_Pillow 51.0/150: 34% focus steady_focus, two_of_dominion
6:00.927 sidewinders Fluffy_Pillow 22.7/150: 15% focus two_of_dominion
6:02.225 barrage Fluffy_Pillow 91.5/150: 61% focus steady_focus, two_of_dominion
6:05.113 aimed_shot Fluffy_Pillow 73.4/150: 49% focus steady_focus, two_of_dominion
6:06.841 sidewinders Fluffy_Pillow 48.4/150: 32% focus marking_targets, steady_focus, two_of_dominion
6:08.140 aimed_shot Fluffy_Pillow 117.2/150: 78% focus bullseye(3), lock_and_load(2), steady_focus, two_of_dominion
6:09.440 aimed_shot Fluffy_Pillow 136.1/150: 91% focus bullseye(4), lock_and_load, steady_focus, two_of_dominion
6:10.738 windburst Fluffy_Pillow 150.0/150: 100% focus bullseye(6), marking_targets, steady_focus, two_of_dominion
6:12.036 aimed_shot Fluffy_Pillow 130.1/150: 87% focus bullseye(6), marking_targets, steady_focus, two_of_dominion
6:13.767 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(8), marking_targets, steady_focus, two_of_dominion
6:15.497 aimed_shot Fluffy_Pillow 75.2/150: 50% focus bullseye(9), marking_targets, steady_focus, two_of_dominion
6:17.228 marked_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(11), marking_targets, steady_focus, six_of_dominion
6:18.525 aimed_shot Fluffy_Pillow 39.0/150: 26% focus bullseye(14), lock_and_load(2), marking_targets, steady_focus, six_of_dominion
6:19.826 aimed_shot Fluffy_Pillow 54.1/150: 36% focus bullseye(15), lock_and_load, marking_targets, six_of_dominion
6:21.126 aimed_shot Fluffy_Pillow 69.2/150: 46% focus bullseye(17), marking_targets, six_of_dominion
6:22.856 Waiting 1.000 sec 39.2/150: 26% focus bullseye(17), marking_targets, six_of_dominion
6:23.856 sidewinders Fluffy_Pillow 50.8/150: 34% focus bullseye(19), marking_targets, six_of_dominion
6:25.154 barrage Fluffy_Pillow 119.6/150: 80% focus bullseye(20), steady_focus, six_of_dominion
6:28.035 potion Fluffy_Pillow 101.4/150: 68% focus bullseye(30), steady_focus, six_of_dominion
6:28.035 trueshot Fluffy_Pillow 101.4/150: 68% focus bullseye(30), steady_focus, six_of_dominion, potion_of_deadly_grace
6:28.035 aimed_shot Fluffy_Pillow 101.4/150: 68% focus bullseye(30), rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:29.272 marked_shot Fluffy_Pillow 76.5/150: 51% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:30.202 aimed_shot Fluffy_Pillow 65.3/150: 44% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:31.438 sidewinders Fluffy_Pillow 40.4/150: 27% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:32.366 windburst Fluffy_Pillow 109.2/150: 73% focus bullseye(30), rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:33.294 aimed_shot Fluffy_Pillow 108.0/150: 72% focus bullseye(30), rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:34.530 aimed_shot Fluffy_Pillow 83.1/150: 55% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, six_of_dominion, potion_of_deadly_grace
6:35.768 aimed_shot Fluffy_Pillow 58.2/150: 39% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:37.006 marked_shot Fluffy_Pillow 33.3/150: 22% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:37.934 sidewinders Fluffy_Pillow 22.2/150: 15% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:38.863 aimed_shot Fluffy_Pillow 91.0/150: 61% focus bullseye(30), rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:40.100 aimed_shot Fluffy_Pillow 66.1/150: 44% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:42.105 aimed_shot Fluffy_Pillow 56.8/150: 38% focus bullseye(30), marking_targets, rapid_killing, steady_focus, trueshot, seven_of_dominion, potion_of_deadly_grace
6:43.342 marked_shot Fluffy_Pillow 30.1/150: 20% focus bullseye(30), marking_targets, steady_focus, seven_of_dominion, potion_of_deadly_grace
6:44.640 sidewinders Fluffy_Pillow 18.9/150: 13% focus bullseye(30), marking_targets, steady_focus, seven_of_dominion, potion_of_deadly_grace
6:45.938 barrage Fluffy_Pillow 87.7/150: 58% focus bullseye(30), steady_focus, seven_of_dominion, potion_of_deadly_grace
6:48.761 aimed_shot Fluffy_Pillow 68.6/150: 46% focus bullseye(30), steady_focus, seven_of_dominion, potion_of_deadly_grace
6:50.490 marked_shot Fluffy_Pillow 43.7/150: 29% focus bullseye(30), steady_focus, seven_of_dominion, potion_of_deadly_grace
6:51.788 sidewinders Fluffy_Pillow 32.5/150: 22% focus bullseye(30), marking_targets, steady_focus, seven_of_dominion, potion_of_deadly_grace
6:53.086 windburst Fluffy_Pillow 101.3/150: 68% focus bullseye(30), steady_focus, seven_of_dominion, potion_of_deadly_grace
6:54.590 aimed_shot Fluffy_Pillow 103.1/150: 69% focus bullseye(30), steady_focus, seven_of_dominion, potion_of_deadly_grace
6:56.320 aimed_shot Fluffy_Pillow 78.1/150: 52% focus bullseye(30), steady_focus, five_of_dominion, potion_of_deadly_grace
6:58.307 aimed_shot Fluffy_Pillow 56.9/150: 38% focus bullseye(30), steady_focus, five_of_dominion
7:00.036 marked_shot Fluffy_Pillow 32.0/150: 21% focus bullseye(30), marking_targets, steady_focus, five_of_dominion
7:01.592 sidewinders Fluffy_Pillow 24.5/150: 16% focus bullseye(30), marking_targets, steady_focus, five_of_dominion
7:02.890 aimed_shot Fluffy_Pillow 93.3/150: 62% focus bullseye(30), steady_focus, five_of_dominion
7:04.619 aimed_shot Fluffy_Pillow 68.4/150: 46% focus bullseye(30), steady_focus, five_of_dominion
7:06.350 marked_shot Fluffy_Pillow 43.5/150: 29% focus bullseye(30), steady_focus, five_of_dominion
7:08.926 aimed_shot Fluffy_Pillow 50.8/150: 34% focus bullseye(30), steady_focus, five_of_dominion
7:10.655 Waiting 2.400 sec 25.8/150: 17% focus bullseye(30), steady_focus, five_of_dominion
7:13.055 barrage Fluffy_Pillow 60.6/150: 40% focus bullseye(30), steady_focus, five_of_dominion
7:15.907 windburst Fluffy_Pillow 35.2/150: 23% focus bullseye(30), two_of_dominion
7:17.204 sidewinders Fluffy_Pillow 30.2/150: 20% focus bullseye(30), marking_targets, two_of_dominion
7:18.502 aimed_shot Fluffy_Pillow 99.0/150: 66% focus bullseye(30), steady_focus, two_of_dominion
7:20.230 aimed_shot Fluffy_Pillow 74.0/150: 49% focus bullseye(30), steady_focus, two_of_dominion
7:21.958 marked_shot Fluffy_Pillow 49.1/150: 33% focus bullseye(30), steady_focus, two_of_dominion
7:23.255 Waiting 0.700 sec 37.9/150: 25% focus bullseye(30), steady_focus, two_of_dominion
7:23.955 sidewinders Fluffy_Pillow 48.0/150: 32% focus bullseye(30), marking_targets, steady_focus, two_of_dominion
7:25.253 aimed_shot Fluffy_Pillow 116.8/150: 78% focus bullseye(30), steady_focus, two_of_dominion
7:26.982 aimed_shot Fluffy_Pillow 91.9/150: 61% focus bullseye(30), marking_targets, steady_focus, two_of_dominion
7:28.711 marked_shot Fluffy_Pillow 66.9/150: 45% focus bullseye(30), marking_targets, steady_focus, two_of_dominion
7:30.009 aimed_shot Fluffy_Pillow 55.7/150: 37% focus bullseye(30), marking_targets, steady_focus, two_of_dominion
7:32.503 sidewinders Fluffy_Pillow 41.9/150: 28% focus bullseye(30), marking_targets, steady_focus, two_of_dominion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6227 6227 0
Agility 24007 22642 12531 (9526)
Stamina 28841 28841 17876
Intellect 6006 6006 0
Spirit 0 0 0
Health 1730460 1730460 0
Focus 150 150 0
Crit 27.10% 24.85% 3098
Haste 15.91% 15.91% 5172
Damage / Heal Versatility 0.90% 0.90% 360
Attack Power 24007 22642 0
Mastery 19.63% 18.96% 7817
Armor 2417 2417 2417
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 843.00
Local Head Gorrog's Serene Gaze
ilevel: 845, stats: { 331 Armor, +1238 AgiInt, +1857 Sta, +888 Mastery, +393 Crit }
Local Neck Queen Yh'saerie's Pendant
ilevel: 835, stats: { +952 Sta, +992 Haste, +744 Mastery }, gems: { +100 Mastery }, enchant: { +75 Mastery }
Local Shoulders Bramblemail Pauldrons
ilevel: 835, stats: { 296 Armor, +846 AgiInt, +1269 Sta, +662 Haste, +264 Mastery }
Local Shirt Brucehide Jersey
ilevel: 1
Local Chest Bramblemail Hauberk
ilevel: 840, stats: { 401 Armor, +1182 AgiInt, +1773 Sta, +899 Haste, +359 Mastery }
Local Waist Thundercaller's Chain
ilevel: 825, stats: { 215 Armor, +1156 Sta, +771 AgiInt, +561 Crit, +331 Mastery }
Local Legs Tideskorn Leggings
ilevel: 845, stats: { 356 Armor, +1238 AgiInt, +1857 Sta, +888 Crit, +393 Mastery }
Local Feet Whelp Handler's Lined Boots
ilevel: 840, stats: { 276 Armor, +886 AgiInt, +1329 Sta, +592 Mastery, +350 Haste }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 840, stats: { 175 Armor, +665 AgiInt, +997 Sta, +459 Mastery, +247 Haste }, gems: { +100 Mastery }
Local Hands Midnight Reaper Handwraps
ilevel: 825, stats: { 239 Armor, +771 AgiInt, +1157 Sta, +541 Crit, +350 Mastery }
Local Finger1 Loop of Vitriolic Intent
ilevel: 845, stats: { +1045 Sta, +1236 Haste, +566 Mastery }, enchant: { +150 Mastery }
Local Finger2 Shadowruby Band of the Feverflare
ilevel: 850, stats: { +1094 Sta, +1049 Mastery, +786 Haste }, gems: { +100 Mastery }, enchant: { +150 Mastery }
Local Trinket1 Tempered Egg of Serpentrix
ilevel: 855, stats: { +1292 Agi }, gems: { +100 Mastery }
Local Trinket2 Darkmoon Deck: Dominion
ilevel: 850, stats: { +1233 StrAgi }
Local Back Cape of Valarjar Courage
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +360 Mastery, +360 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 870, weapon: { 8423 - 8425, 3 }, stats: { +1563 Agi, +2345 Sta, +715 Crit, +687 Mastery }, relics: { +37 ilevels, +40 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Dash
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Ptitchu"
origin="https://eu.api.battle.net/wow/character/hyjal/Ptitchu/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/201/115117257-avatar.jpg"
level=110
race=night_elf
timeofday=day
role=attack
position=ranged_back
professions=tailoring=755/enchanting=737
talents=http://eu.battle.net/wow/en/tool/talent-calculator#YZ!1002010
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:316:1:319:3:320:3:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows
actions+=/barrage
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=active_enemies<2&buff.marking_targets.down&(debuff.vulnerability.down|debuff.vulnerability.remains<cast_time)
actions+=/windburst,if=active_enemies<2&buff.marking_targets.down&focus+cast_regen>90
actions+=/windburst,if=active_enemies<2&cooldown.sidewinders.charges=0
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&active_enemies=1&debuff.vulnerability.react<3&buff.marking_targets.react&debuff.hunters_mark.down
actions+=/marked_shot,if=!talent.patient_sniper.enabled&debuff.vulnerability.react<3
actions+=/marked_shot,if=prev_off_gcd.sentinel
actions+=/sentinel,if=debuff.hunters_mark.down&buff.marking_targets.down
actions+=/explosive_shot
actions+=/marked_shot,if=active_enemies>=4&cooldown.sidewinders.charges_fractional>=0.8
actions+=/sidewinders,if=active_enemies>1&debuff.hunters_mark.down&(buff.marking_targets.react|buff.trueshot.react|charges=2)
actions+=/arcane_shot,if=talent.steady_focus.enabled&active_enemies=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&active_enemies>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/arcane_shot,if=talent.true_aim.enabled&active_enemies=1&(debuff.true_aim.react<1|debuff.true_aim.remains<2)
actions+=/aimed_shot,if=buff.lock_and_load.up&debuff.vulnerability.remains>gcd.max
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/marked_shot,if=!talent.sidewinders.enabled&(debuff.vulnerability.remains<2|buff.marking_targets.react)
actions+=/pool_resource,for_next=1,if=talent.sidewinders.enabled&(focus<60&cooldown.sidewinders.charges_fractional<=1.2)
actions+=/aimed_shot,if=cast_time<debuff.vulnerability.remains&(focus+cast_regen>80|debuff.hunters_mark.down)
actions+=/marked_shot
actions+=/black_arrow
actions+=/sidewinders,if=debuff.hunters_mark.down&(buff.marking_targets.remains>6|buff.trueshot.react|charges=2)
actions+=/sidewinders,if=focus<30&charges<=1&recharge_time<=5
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/arcane_shot,if=focus.deficit<10

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23
actions.cooldowns+=/trueshot,if=(buff.bloodlust.react|target.health.pct>20+(cooldown.trueshot.remains+15))|buff.bullseye.react>25

head=gorrogs_serene_gaze,id=141575,bonus_id=1507/3336
neck=queen_yhsaeries_pendant,id=141587,bonus_id=1808/1497,gems=100mastery,enchant=75mastery
shoulders=bramblemail_pauldrons,id=139083,bonus_id=3432/1497/1674
back=cape_of_valarjar_courage,id=133765,bonus_id=1726/1497/3337,enchant=150agi
chest=bramblemail_hauberk,id=139084,bonus_id=3397/1502/3336
shirt=brucehide_jersey,id=98085
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3395/1808/1502/3337,gems=100mastery
hands=midnight_reaper_handwraps,id=134469,bonus_id=1726/1477
waist=thundercallers_chain,id=133805,bonus_id=1726/1477
legs=tideskorn_leggings,id=134212,bonus_id=3397/1507/3337
feet=whelp_handlers_lined_boots,id=134464,bonus_id=1727/1492/1813
finger1=loop_of_vitriolic_intent,id=134530,bonus_id=1727/1497/3336,enchant=150mastery
finger2=shadowruby_band,id=136713,bonus_id=3357/689/600/669,gems=100mastery,enchant=150mastery
trinket1=tempered_egg_of_serpentrix,id=137373,bonus_id=1727/1808/1507/3337,gems=100mastery
trinket2=darkmoon_deck_dominion,id=128705,bonus_id=689/600/669
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=136974/137363/141256/0,relic_id=1726:1482:3339/1727:1492:1813/3432:1512:3337/0

# Gear Summary
# gear_ilvl=843.00
# gear_agility=12531
# gear_stamina=17876
# gear_crit_rating=3098
# gear_haste_rating=5172
# gear_mastery_rating=7817
# gear_versatility_rating=360
# gear_armor=2417
summon_pet=cat

Lâstykökö

Lâstykökö : 220923 dps

  • Race: Gnome
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
220923.0 220923.0 147.7 / 0.067% 28088.9 / 12.7% 10.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
18962.9 18962.9 Mana 0.40% 51.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced
Talents
  • 15: Pyromaniac (Fire Mage)
  • 30: Cauterize
  • 45: Mirror Image
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Unstable Magic
  • 100: Meteor (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • inscription: 727
  • tailoring: 797

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Lâstykökö 220923
Deadly Grace 7776 3.5% 22.0 7.26sec 156936 0 Direct 22.0 79173 183894 156936 74.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.97 21.97 0.00 0.00 0.0000 0.0000 3447122.27 3447122.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 25.74% 79173.00 79173 79173 79093.82 0 79173 447697 447697 0.00
crit 16.31 74.26% 183894.47 158346 197933 183875.81 169917 196349 2999425 2999425 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dragon's Breath 12933 5.8% 20.9 21.89sec 277122 216281 Direct 20.9 163904 361692 277117 57.2%  

Stats details: dragons_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.94 20.94 0.00 0.00 1.2813 0.0000 5804324.14 5804324.14 0.00 216280.66 216280.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.96 42.76% 163903.90 163904 163904 163903.90 163904 163904 1467857 1467857 0.00
crit 11.99 57.24% 361692.20 334364 417955 361966.85 338544 409596 4336467 4336467 0.00
 
 

Action details: dragons_breath

Static Values
  • id:31661
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132863
Spelldata
  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s1=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fire Blast 12575 5.7% 54.6 8.28sec 103390 0 Direct 54.6 0 103391 103391 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.64 54.64 0.00 0.00 0.0000 0.0000 5648740.86 5648740.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 54.64 100.00% 103390.70 93622 117027 103421.60 100608 107318 5648741 5648741 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. This damage is always a critical strike. Unaffected by the global cooldown and castable while casting.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 33395 15.2% 136.7 3.20sec 110157 63612 Direct 136.5 62530 136912 110324 64.3%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.70 136.50 0.00 0.00 1.7317 0.0000 15058728.16 15058728.16 0.00 63612.21 63612.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.79 35.75% 62530.46 62530 62530 62530.46 62530 62530 3050904 3050904 0.00
crit 87.70 64.25% 136911.73 127562 159453 136894.56 131814 142962 12007825 12007825 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 40456 18.3% 335.2 1.35sec 54156 0 Periodic 449.3 40407 0 40407 0.0% 99.7%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 335.24 0.00 449.31 449.31 0.0000 1.0000 18155097.53 18155097.53 0.00 40407.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 449.3 100.00% 40407.24 2404 191298 40571.91 34999 47416 18155098 18155098 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Meteor 0 (7739) 0.0% (3.5%) 7.8 57.69sec 441038 349681

Stats details: meteor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 0.00 54.17 0.00 1.2613 1.1438 0.00 0.00 0.00 48072.08 349681.09
 
 

Action details: meteor

Static Values
  • id:153561
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
Spelldata
  • id:153561
  • name:Meteor
  • school:fire
  • tooltip:
  • description:Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Meteor (_impact) 6181 2.8% 7.8 57.80sec 352978 0 Direct 7.8 184393 406312 353472 76.2%  

Stats details: meteor_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.80 0.00 0.00 0.0000 0.0000 2757983.55 2757983.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.86 23.81% 184392.92 184393 184393 167242.66 0 184393 342544 342544 0.00
crit 5.94 76.19% 406312.40 376162 470202 406302.60 376162 455155 2415439 2415439 0.00
 
 

Action details: meteor_impact

Static Values
  • id:153564
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153564
  • name:Meteor
  • school:fire
  • tooltip:
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.625000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Meteor Burn 1557 0.7% 54.2 7.48sec 12837 0 Periodic 54.2 6146 14912 12838 76.3% 0.0%

Stats details: meteor_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.17 0.00 0.00 54.17 0.0000 0.0000 695466.85 695466.85 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.8 23.66% 6146.40 6146 6146 6146.40 6146 6146 78795 78795 0.00
crit 41.4 76.34% 14911.55 12539 15673 14919.58 13959 15630 616671 616671 0.00
 
 

Action details: meteor_burn

Static Values
  • id:155158
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:155158
  • name:Meteor Burn
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$153564s1=1} Fire damage, split evenly between all targets within 8 yards, and burns the ground, dealing ${8*{$155158s1=0}} Fire damage over {$175396d=8 seconds} to all enemies in the area. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mirror Image 0 (19797) 0.0% (9.0%) 4.3 120.62sec 2066291 2070919

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 0.00 0.00 0.9980 0.0000 0.00 0.00 0.00 2070918.68 2070918.68
 
 

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:
  • description:Creates {$s2=3} copies of you nearby, which cast spells and attack your enemies. Lasts {$55342d=40 seconds}.
 
    Fireball (mirror_image) 54595 9.0% 235.3 5.49sec 37847 18752 Direct 234.6 22915 45829 37963 65.7%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 235.29 234.57 0.00 0.00 2.0183 0.0000 8904950.32 8904950.32 0.00 18751.92 18751.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.53 34.33% 22914.72 22915 22915 22914.72 22915 22915 1845278 1845278 0.00
crit 154.04 65.67% 45829.44 45829 45829 45829.44 45829 45829 7059673 7059673 0.00
 
 

Action details: fireball

Static Values
  • id:88082
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88082
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Hurls a fiery ball that causes {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.720000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix Reborn 2349 1.1% 37.4 11.78sec 28285 0 Direct 37.4 16390 36943 28285 57.9%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.40 37.40 0.00 0.00 0.0000 0.0000 1057979.81 1057979.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.76 42.13% 16390.39 16390 16390 16390.39 16390 16390 258283 258283 0.00
crit 21.65 57.87% 36943.36 33436 41795 36952.85 33994 39772 799697 799697 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 10322 4.7% 20.5 22.20sec 226038 181926 Direct 20.5 0 226320 226320 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.54 20.51 0.00 0.00 1.2425 0.0000 4642014.49 4642014.49 0.00 181925.63 181925.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 20.51 100.00% 226319.85 200620 250776 226411.45 212475 243531 4642014 4642014 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pyroblast 69374 31.4% 114.6 3.92sec 272069 216104 Direct 115.4 141614 334511 270149 66.6%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.56 115.38 0.00 0.00 1.2590 0.0000 31169127.08 31169127.08 0.00 216104.10 216104.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.50 33.37% 141614.08 141614 141614 141614.08 141614 141614 5451597 5451597 0.00
crit 76.88 66.63% 334511.41 288893 361116 334526.57 324282 344449 25717530 25717530 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 44 0.0% 0.5 14.03sec 41172 31720 Direct 0.5 0 41172 41172 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.48 0.00 0.00 1.2995 0.0000 19793.39 19793.39 0.00 31720.18 31720.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.48 100.00% 41172.19 33438 41798 12172.82 0 41798 19793 19793 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unstable Magic (_explosion) 4164 1.9% 34.0 12.64sec 55197 0 Direct 34.0 55198 0 55198 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.01 34.01 0.00 0.00 0.0000 0.0000 1877285.01 1877285.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.01 100.00% 55197.52 31265 79726 55222.07 43137 69061 1877285 1877285 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=15}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63781.07
  • base_dd_max:63781.07
 
Simple Action Stats Execute Interval
Lâstykökö
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Combustion 3.9 120.78sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%. Mastery increased by $w2.
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Unaffected by the global cooldown and castable while casting.
 
Counterspell 11.0 42.33sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 7.7 58.94sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lâstykökö
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 20.5 22.20sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.51 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 15.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 3.9 0.0 120.8sec 120.8sec 8.72% 13.79% 77.6(77.6) 3.8

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:8.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%. Mastery increased by $w2.
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Unaffected by the global cooldown and castable while casting.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 36.1 12.7 12.1sec 8.9sec 34.01% 27.72% 0.0(0.0) 0.6

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:26.85%
  • enhanced_pyrotechnics_2:6.06%
  • enhanced_pyrotechnics_3:1.03%
  • enhanced_pyrotechnics_4:0.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 117.2 0.0 3.8sec 3.8sec 31.70% 47.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:31.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 105.8 0.0 4.2sec 4.2sec 28.78% 42.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:28.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 123.3sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 67.6 184.6 6.7sec 1.8sec 68.81% 78.15% 58.9(58.9) 0.0

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:21.65%
  • pyretic_incantation_2:13.49%
  • pyretic_incantation_3:6.23%
  • pyretic_incantation_4:8.50%
  • pyretic_incantation_5:18.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=15}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Lâstykökö
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Lâstykökö
combustion Mana 3.9 430205.9 110000.0 109999.2 0.0
counterspell Mana 11.0 241670.2 22000.0 21999.2 0.0
dragons_breath Mana 20.9 921603.7 44000.0 44001.1 6.3
fire_blast Mana 54.6 600988.9 11000.0 11000.1 9.4
fireball Mana 136.7 3007466.2 22000.0 22000.1 5.0
meteor Mana 7.8 86132.4 11000.0 10999.9 40.1
mirror_image Mana 4.3 72806.4 16894.9 16893.9 122.3
pyroblast Mana 115.6 3177955.2 27500.0 27739.8 9.8
scorch Mana 0.5 5285.1 11000.0 10993.5 3.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 620.59 7424719.48 (100.00%) 11963.96 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 16478.48 18962.86
Combat End Resource Mean Min Max
Mana 34960.07 110.00 288612.50

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Heating Up generated 117.2 3.8sec
Heating Up removed 11.0 35.7sec
IB conversions of HU 54.3 8.3sec
Total Hot Streak procs 105.8 4.2sec
Hot Streak spells used 327.5 1.4sec
Hot Streak spell crits 240.2 1.9sec
Wasted Hot Streak spell crits 17.2 24.8sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Lâstykökö Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Lâstykökö Damage Per Second
Count 9999
Mean 220922.99
Minimum 198184.62
Maximum 251353.59
Spread ( max - min ) 53168.97
Range [ ( max - min ) / 2 * 100% ] 12.03%
Standard Deviation 7536.7710
5th Percentile 208978.06
95th Percentile 233349.38
( 95th Percentile - 5th Percentile ) 24371.33
Mean Distribution
Standard Deviation 75.3715
95.00% Confidence Intervall ( 220775.27 - 221070.72 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4470
0.1 Scale Factor Error with Delta=300 484902
0.05 Scale Factor Error with Delta=300 1939609
0.01 Scale Factor Error with Delta=300 48490236
Priority Target DPS
Sample Data Lâstykökö Priority Target Damage Per Second
Count 9999
Mean 220922.99
Minimum 198184.62
Maximum 251353.59
Spread ( max - min ) 53168.97
Range [ ( max - min ) / 2 * 100% ] 12.03%
Standard Deviation 7536.7710
5th Percentile 208978.06
95th Percentile 233349.38
( 95th Percentile - 5th Percentile ) 24371.33
Mean Distribution
Standard Deviation 75.3715
95.00% Confidence Intervall ( 220775.27 - 221070.72 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4470
0.1 Scale Factor Error with Delta=300 484902
0.05 Scale Factor Error with Delta=300 1939609
0.01 Scale Factor Error with Delta=300 48490236
DPS(e)
Sample Data Lâstykökö Damage Per Second (Effective)
Count 9999
Mean 220922.99
Minimum 198184.62
Maximum 251353.59
Spread ( max - min ) 53168.97
Range [ ( max - min ) / 2 * 100% ] 12.03%
Damage
Sample Data Lâstykökö Damage
Count 9999
Mean 90333663.13
Minimum 67599381.51
Maximum 113654289.02
Spread ( max - min ) 46054907.52
Range [ ( max - min ) / 2 * 100% ] 25.49%
DTPS
Sample Data Lâstykökö Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Lâstykökö Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Lâstykökö Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Lâstykökö Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Lâstykökö Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Lâstykökö Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data LâstykököTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Lâstykökö Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 10.99 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=target.health.pct<25|time=0
0.00 shard_of_the_exodar_warp,if=buff.bloodlust.down
8 3.31 mirror_image,if=buff.combustion.down
0.00 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 7.68 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
D 7.83 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
E 20.95 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
0.00 rune_of_power,if=buff.combustion.down
F 0.00 call_action_list,name=active_talents
G 3.91 combustion
H 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent
I 24.67 pyroblast,if=buff.hot_streak.up
J 16.95 fire_blast,if=buff.heating_up.up
K 7.24 phoenixs_flames
L 0.49 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.single_target
# count action,conditions
N 0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
O 89.89 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 0.00 call_action_list,name=active_talents
Q 37.69 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
0.00 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
R 13.30 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
S 137.19 fireball

Sample Sequence

012456EGDKJI7JCIJIIJIKIKOSSQOSSOSOESSQOSROQSOSSSSQOSS7SEODQOROCQSOQSOSOSQOEOSSROQSOSO7SSOSEQOSSSSQOSSSSQOSOEOSSO7SSO8GDHIJCIJIIEJIKORSQOSSSSSSEOSO7QROSSSSQOSODESSQOCSOROQSOSOSS7ESSQOQSOSSROQSOSOESSSSQOSSOSSOSOEOSS8GDJIJCIIJIJIKIROESQOSSO7ROSQOSSOROESSQOSSODQOCQSOSOROE7QOSSQOSSSQOSSSSESSQOSSOSOQSO7SSOEOQSOSOSSOSOS8GDEIJIJCIJIJKIRO7ROSSSQOESSSQOSOSSOSOQSOSDEQS7CROQSOQSOSOSOSSQOROSESSQOSSQS7SO

Sample Sequence Table

time name target resources buffs
Pre flask Lâstykökö 1155000.0/1155000: 100% mana
Pre food Lâstykökö 1155000.0/1155000: 100% mana
Pre augmentation Lâstykökö 1155000.0/1155000: 100% mana
Pre mirror_image Fluffy_Pillow 1155000.0/1155000: 100% mana
Pre potion Fluffy_Pillow 1155000.0/1155000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:00.000 dragons_breath Fluffy_Pillow 1127500.0/1155000: 98% mana potion_of_deadly_grace
0:01.229 combustion Fluffy_Pillow 1103778.5/1155000: 96% mana bloodlust, potion_of_deadly_grace
0:01.229 meteor Fluffy_Pillow 993778.5/1155000: 86% mana bloodlust, combustion, potion_of_deadly_grace
0:02.229 phoenixs_flames Fluffy_Pillow 999278.5/1155000: 87% mana bloodlust, combustion, potion_of_deadly_grace
0:03.229 fire_blast Fluffy_Pillow 1015778.5/1155000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation, potion_of_deadly_grace
0:03.229 pyroblast Fluffy_Pillow 1004778.5/1155000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:04.229 counterspell Fluffy_Pillow 993778.5/1155000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
0:04.229 fire_blast Fluffy_Pillow 971778.5/1155000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
0:04.229 flame_on Fluffy_Pillow 960778.5/1155000: 83% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:04.229 pyroblast Fluffy_Pillow 960778.5/1155000: 83% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:05.230 fire_blast Fluffy_Pillow 949795.0/1155000: 82% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:05.230 pyroblast Fluffy_Pillow 938795.0/1155000: 81% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:06.230 pyroblast Fluffy_Pillow 927795.0/1155000: 80% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:07.231 fire_blast Fluffy_Pillow 916811.5/1155000: 79% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:07.231 pyroblast Fluffy_Pillow 905811.5/1155000: 78% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:08.231 phoenixs_flames Fluffy_Pillow 894811.5/1155000: 77% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:09.231 pyroblast Fluffy_Pillow 911311.5/1155000: 79% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:10.231 phoenixs_flames Fluffy_Pillow 900311.5/1155000: 78% mana bloodlust, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:11.232 pyroblast Fluffy_Pillow 916828.0/1155000: 79% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:12.232 fireball Fluffy_Pillow 905828.0/1155000: 78% mana bloodlust, potion_of_deadly_grace
0:13.596 fireball Fluffy_Pillow 906334.0/1155000: 78% mana bloodlust, potion_of_deadly_grace
0:14.962 fire_blast Fluffy_Pillow 906873.0/1155000: 79% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:14.962 pyroblast Fluffy_Pillow 895873.0/1155000: 78% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:15.963 fireball Fluffy_Pillow 884889.5/1155000: 77% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
0:17.327 fireball Fluffy_Pillow 885395.5/1155000: 77% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
0:18.689 pyroblast Fluffy_Pillow 885868.5/1155000: 77% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:19.689 fireball Fluffy_Pillow 874868.5/1155000: 76% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:21.054 pyroblast Fluffy_Pillow 875391.0/1155000: 76% mana bloodlust, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
0:22.055 dragons_breath Fluffy_Pillow 864407.5/1155000: 75% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:23.056 fireball Fluffy_Pillow 836924.0/1155000: 72% mana bloodlust, enhanced_pyrotechnics, pyretic_incantation
0:24.420 fireball Fluffy_Pillow 837430.0/1155000: 73% mana bloodlust, enhanced_pyrotechnics, pyretic_incantation
0:25.784 fire_blast Fluffy_Pillow 837936.0/1155000: 73% mana bloodlust, heating_up, pyretic_incantation(2)
0:25.784 pyroblast Fluffy_Pillow 826936.0/1155000: 72% mana bloodlust, hot_streak, pyretic_incantation(3)
0:26.784 fireball Fluffy_Pillow 815936.0/1155000: 71% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:28.147 phoenixs_flames Fluffy_Pillow 816425.5/1155000: 71% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:29.150 pyroblast Fluffy_Pillow 832975.0/1155000: 72% mana bloodlust, hot_streak, pyretic_incantation(3)
0:30.153 fire_blast Fluffy_Pillow 822024.5/1155000: 71% mana bloodlust, heating_up, pyretic_incantation(4)
0:30.153 fireball Fluffy_Pillow 811024.5/1155000: 70% mana bloodlust, hot_streak, pyretic_incantation(5)
0:31.517 pyroblast Fluffy_Pillow 811530.5/1155000: 70% mana bloodlust, hot_streak, pyretic_incantation(5)
0:32.516 fireball Fluffy_Pillow 800514.0/1155000: 69% mana bloodlust, enhanced_pyrotechnics
0:33.879 fireball Fluffy_Pillow 801003.5/1155000: 69% mana bloodlust, enhanced_pyrotechnics
0:35.241 fireball Fluffy_Pillow 801476.5/1155000: 69% mana bloodlust, heating_up, pyretic_incantation
0:36.605 fireball Fluffy_Pillow 801982.5/1155000: 69% mana bloodlust, enhanced_pyrotechnics
0:37.969 fire_blast Fluffy_Pillow 802488.5/1155000: 69% mana bloodlust, heating_up, pyretic_incantation
0:37.969 pyroblast Fluffy_Pillow 791488.5/1155000: 69% mana bloodlust, hot_streak, pyretic_incantation(2)
0:38.969 fireball Fluffy_Pillow 780488.5/1155000: 68% mana bloodlust, heating_up
0:40.333 fireball Fluffy_Pillow 780994.5/1155000: 68% mana bloodlust, heating_up
0:41.697 counterspell Fluffy_Pillow 781500.5/1155000: 68% mana enhanced_pyrotechnics
0:41.697 fireball Fluffy_Pillow 759500.5/1155000: 66% mana enhanced_pyrotechnics
0:43.468 dragons_breath Fluffy_Pillow 766722.0/1155000: 66% mana heating_up, pyretic_incantation
0:44.767 pyroblast Fluffy_Pillow 744155.5/1155000: 64% mana hot_streak, pyretic_incantation(3)
0:46.068 meteor Fluffy_Pillow 738122.0/1155000: 64% mana heating_up, pyretic_incantation(4)
0:47.528 fire_blast Fluffy_Pillow 751212.0/1155000: 65% mana heating_up, pyretic_incantation(4)
0:47.528 pyroblast Fluffy_Pillow 740212.0/1155000: 64% mana hot_streak, pyretic_incantation(5)
0:48.827 phoenixs_flames Fluffy_Pillow 734145.5/1155000: 64% mana hot_streak, pyretic_incantation(5)
0:50.126 pyroblast Fluffy_Pillow 755579.0/1155000: 65% mana hot_streak, pyretic_incantation(5)
0:51.427 flame_on Fluffy_Pillow 749545.5/1155000: 65% mana heating_up, pyretic_incantation(5)
0:51.427 fire_blast Fluffy_Pillow 749545.5/1155000: 65% mana heating_up, pyretic_incantation(5)
0:51.427 fireball Fluffy_Pillow 738545.5/1155000: 64% mana hot_streak, pyretic_incantation(5)
0:53.199 pyroblast Fluffy_Pillow 745783.5/1155000: 65% mana hot_streak, pyretic_incantation(5)
0:54.497 fire_blast Fluffy_Pillow 739700.5/1155000: 64% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
0:54.497 fireball Fluffy_Pillow 728700.5/1155000: 63% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:56.271 pyroblast Fluffy_Pillow 735971.5/1155000: 64% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:57.570 fireball Fluffy_Pillow 729905.0/1155000: 63% mana hot_streak, pyretic_incantation(4)
0:59.342 pyroblast Fluffy_Pillow 737143.0/1155000: 64% mana hot_streak, pyretic_incantation(4)
1:00.640 fireball Fluffy_Pillow 731060.0/1155000: 63% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:02.414 fire_blast Fluffy_Pillow 738331.0/1155000: 64% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:02.414 pyroblast Fluffy_Pillow 727331.0/1155000: 63% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
1:03.712 dragons_breath Fluffy_Pillow 721248.0/1155000: 62% mana hot_streak, pyretic_incantation(4)
1:05.010 pyroblast Fluffy_Pillow 698665.0/1155000: 60% mana hot_streak, pyretic_incantation(5)
1:06.309 fireball Fluffy_Pillow 692598.5/1155000: 60% mana heating_up, pyretic_incantation(5)
1:08.083 fireball Fluffy_Pillow 699869.5/1155000: 61% mana heating_up, pyretic_incantation(5)
1:09.856 phoenixs_flames Fluffy_Pillow 707124.0/1155000: 61% mana enhanced_pyrotechnics
1:11.157 pyroblast Fluffy_Pillow 728590.5/1155000: 63% mana hot_streak, pyretic_incantation(2)
1:12.456 fire_blast Fluffy_Pillow 722524.0/1155000: 63% mana heating_up, pyretic_incantation(3)
1:12.456 fireball Fluffy_Pillow 711524.0/1155000: 62% mana hot_streak, pyretic_incantation(4)
1:14.228 pyroblast Fluffy_Pillow 718762.0/1155000: 62% mana hot_streak, pyretic_incantation(4)
1:15.526 fireball Fluffy_Pillow 712679.0/1155000: 62% mana hot_streak, pyretic_incantation(5)
1:17.299 pyroblast Fluffy_Pillow 719933.5/1155000: 62% mana hot_streak, pyretic_incantation(5)
1:18.597 counterspell Fluffy_Pillow 713850.5/1155000: 62% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:18.597 fireball Fluffy_Pillow 691850.5/1155000: 60% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:20.369 fireball Fluffy_Pillow 699088.5/1155000: 61% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:22.142 pyroblast Fluffy_Pillow 706343.0/1155000: 61% mana hot_streak, pyretic_incantation(2)
1:23.442 fireball Fluffy_Pillow 700293.0/1155000: 61% mana enhanced_pyrotechnics
1:25.213 dragons_breath Fluffy_Pillow 707514.5/1155000: 61% mana enhanced_pyrotechnics
1:26.512 fire_blast Fluffy_Pillow 684948.0/1155000: 59% mana heating_up, pyretic_incantation
1:26.512 pyroblast Fluffy_Pillow 673948.0/1155000: 58% mana hot_streak, pyretic_incantation(2)
1:27.812 fireball Fluffy_Pillow 667898.0/1155000: 58% mana
1:29.584 fireball Fluffy_Pillow 675136.0/1155000: 58% mana
1:31.358 fireball Fluffy_Pillow 682407.0/1155000: 59% mana enhanced_pyrotechnics
1:33.130 fireball Fluffy_Pillow 689645.0/1155000: 60% mana enhanced_pyrotechnics(2)
1:34.903 fire_blast Fluffy_Pillow 696899.5/1155000: 60% mana heating_up, pyretic_incantation
1:34.903 pyroblast Fluffy_Pillow 685899.5/1155000: 59% mana hot_streak, pyretic_incantation(2)
1:36.202 fireball Fluffy_Pillow 679833.0/1155000: 59% mana enhanced_pyrotechnics
1:37.975 fireball Fluffy_Pillow 687087.5/1155000: 59% mana enhanced_pyrotechnics
1:39.748 fireball Fluffy_Pillow 694342.0/1155000: 60% mana heating_up, pyretic_incantation
1:41.520 fireball Fluffy_Pillow 701580.0/1155000: 61% mana enhanced_pyrotechnics
1:43.292 fire_blast Fluffy_Pillow 708818.0/1155000: 61% mana heating_up, pyretic_incantation
1:43.292 pyroblast Fluffy_Pillow 697818.0/1155000: 60% mana hot_streak, pyretic_incantation(2)
1:44.592 fireball Fluffy_Pillow 691768.0/1155000: 60% mana hot_streak, pyretic_incantation(4)
1:46.364 pyroblast Fluffy_Pillow 699006.0/1155000: 61% mana hot_streak, pyretic_incantation(4)
1:47.662 dragons_breath Fluffy_Pillow 692923.0/1155000: 60% mana hot_streak, pyretic_incantation(5)
1:48.962 pyroblast Fluffy_Pillow 670373.0/1155000: 58% mana hot_streak
1:50.258 fireball Fluffy_Pillow 664257.0/1155000: 58% mana heating_up, pyretic_incantation
1:52.030 fireball Fluffy_Pillow 671495.0/1155000: 58% mana heating_up, pyretic_incantation
1:53.802 pyroblast Fluffy_Pillow 678733.0/1155000: 59% mana hot_streak, pyretic_incantation(2)
1:55.101 counterspell Fluffy_Pillow 672666.5/1155000: 58% mana heating_up
1:55.101 fireball Fluffy_Pillow 650666.5/1155000: 56% mana heating_up
1:56.874 fireball Fluffy_Pillow 657921.0/1155000: 57% mana heating_up
1:58.647 pyroblast Fluffy_Pillow 665175.5/1155000: 58% mana hot_streak, pyretic_incantation
1:59.946 mirror_image Fluffy_Pillow 659109.0/1155000: 57% mana hot_streak, pyretic_incantation(3)
2:01.300 combustion Fluffy_Pillow 659450.0/1155000: 57% mana hot_streak, pyretic_incantation(3)
2:01.300 meteor Fluffy_Pillow 549450.0/1155000: 48% mana combustion, hot_streak, pyretic_incantation(3)
2:02.599 potion Fluffy_Pillow 559883.5/1155000: 48% mana combustion, hot_streak, pyretic_incantation(3)
2:02.599 pyroblast Fluffy_Pillow 559883.5/1155000: 48% mana combustion, hot_streak, pyretic_incantation(3), potion_of_deadly_grace
2:03.899 fire_blast Fluffy_Pillow 553833.5/1155000: 48% mana combustion, heating_up, pyretic_incantation(4), potion_of_deadly_grace
2:03.899 flame_on Fluffy_Pillow 542833.5/1155000: 47% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:03.899 pyroblast Fluffy_Pillow 542833.5/1155000: 47% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:05.199 fire_blast Fluffy_Pillow 536783.5/1155000: 46% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:05.199 pyroblast Fluffy_Pillow 525783.5/1155000: 46% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:06.497 pyroblast Fluffy_Pillow 519700.5/1155000: 45% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:07.797 dragons_breath Fluffy_Pillow 513650.5/1155000: 44% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:09.097 fire_blast Fluffy_Pillow 491100.5/1155000: 43% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:09.097 pyroblast Fluffy_Pillow 480100.5/1155000: 42% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:10.397 phoenixs_flames Fluffy_Pillow 474050.5/1155000: 41% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
2:11.696 pyroblast Fluffy_Pillow 495484.0/1155000: 43% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
2:12.997 phoenixs_flames Fluffy_Pillow 489450.5/1155000: 42% mana potion_of_deadly_grace
2:14.297 fireball Fluffy_Pillow 510900.5/1155000: 44% mana heating_up, pyretic_incantation, potion_of_deadly_grace
2:16.069 fire_blast Fluffy_Pillow 518138.5/1155000: 45% mana heating_up, pyretic_incantation, potion_of_deadly_grace
2:16.069 pyroblast Fluffy_Pillow 507138.5/1155000: 44% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
2:17.370 fireball Fluffy_Pillow 501105.0/1155000: 43% mana heating_up, potion_of_deadly_grace
2:19.144 fireball Fluffy_Pillow 508376.0/1155000: 44% mana heating_up, potion_of_deadly_grace
2:20.916 fireball Fluffy_Pillow 515614.0/1155000: 45% mana enhanced_pyrotechnics, potion_of_deadly_grace
2:22.688 fireball Fluffy_Pillow 522852.0/1155000: 45% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
2:24.461 fireball Fluffy_Pillow 530106.5/1155000: 46% mana heating_up, pyretic_incantation, potion_of_deadly_grace
2:26.233 fireball Fluffy_Pillow 537344.5/1155000: 47% mana enhanced_pyrotechnics, potion_of_deadly_grace
2:28.005 dragons_breath Fluffy_Pillow 544582.5/1155000: 47% mana heating_up, pyretic_incantation
2:29.303 pyroblast Fluffy_Pillow 521999.5/1155000: 45% mana hot_streak, pyretic_incantation
2:30.601 fireball Fluffy_Pillow 515916.5/1155000: 45% mana hot_streak, pyretic_incantation(2)
2:32.374 pyroblast Fluffy_Pillow 523171.0/1155000: 45% mana hot_streak, pyretic_incantation(2)
2:33.675 counterspell Fluffy_Pillow 517137.5/1155000: 45% mana heating_up
2:33.675 fire_blast Fluffy_Pillow 495137.5/1155000: 43% mana heating_up
2:33.675 phoenixs_flames Fluffy_Pillow 484137.5/1155000: 42% mana hot_streak, pyretic_incantation
2:34.972 pyroblast Fluffy_Pillow 505538.0/1155000: 44% mana hot_streak, pyretic_incantation(2)
2:36.271 fireball Fluffy_Pillow 499471.5/1155000: 43% mana
2:38.045 fireball Fluffy_Pillow 506742.5/1155000: 44% mana
2:39.818 fireball Fluffy_Pillow 513997.0/1155000: 45% mana enhanced_pyrotechnics
2:41.591 fireball Fluffy_Pillow 521251.5/1155000: 45% mana enhanced_pyrotechnics(2)
2:43.364 fire_blast Fluffy_Pillow 528506.0/1155000: 46% mana heating_up, pyretic_incantation
2:43.364 pyroblast Fluffy_Pillow 517506.0/1155000: 45% mana hot_streak, pyretic_incantation(2)
2:44.662 fireball Fluffy_Pillow 511423.0/1155000: 44% mana hot_streak, pyretic_incantation(4)
2:46.435 pyroblast Fluffy_Pillow 518677.5/1155000: 45% mana hot_streak, pyretic_incantation(4)
2:47.737 meteor Fluffy_Pillow 512660.5/1155000: 44% mana enhanced_pyrotechnics
2:49.037 dragons_breath Fluffy_Pillow 523110.5/1155000: 45% mana enhanced_pyrotechnics
2:50.336 fireball Fluffy_Pillow 500544.0/1155000: 43% mana enhanced_pyrotechnics
2:52.109 fireball Fluffy_Pillow 507798.5/1155000: 44% mana enhanced_pyrotechnics
2:53.882 fire_blast Fluffy_Pillow 515053.0/1155000: 45% mana heating_up, pyretic_incantation
2:53.882 pyroblast Fluffy_Pillow 504053.0/1155000: 44% mana hot_streak, pyretic_incantation(2)
2:55.182 flame_on Fluffy_Pillow 498003.0/1155000: 43% mana hot_streak, pyretic_incantation(4)
2:55.182 fireball Fluffy_Pillow 498003.0/1155000: 43% mana hot_streak, pyretic_incantation(4)
2:56.954 pyroblast Fluffy_Pillow 505241.0/1155000: 44% mana hot_streak, pyretic_incantation(4)
2:58.252 phoenixs_flames Fluffy_Pillow 499158.0/1155000: 43% mana hot_streak, pyretic_incantation(5)
2:59.551 pyroblast Fluffy_Pillow 520591.5/1155000: 45% mana hot_streak, pyretic_incantation(5)
3:00.850 fire_blast Fluffy_Pillow 514525.0/1155000: 45% mana heating_up, pyretic_incantation(5)
3:00.850 fireball Fluffy_Pillow 503525.0/1155000: 44% mana hot_streak, pyretic_incantation(5)
3:02.623 pyroblast Fluffy_Pillow 510779.5/1155000: 44% mana hot_streak, pyretic_incantation(5)
3:03.923 fireball Fluffy_Pillow 504729.5/1155000: 44% mana enhanced_pyrotechnics, hot_streak
3:05.696 pyroblast Fluffy_Pillow 511984.0/1155000: 44% mana enhanced_pyrotechnics, hot_streak
3:06.995 fireball Fluffy_Pillow 505917.5/1155000: 44% mana enhanced_pyrotechnics(2)
3:08.765 fireball Fluffy_Pillow 513122.5/1155000: 44% mana enhanced_pyrotechnics(2)
3:10.537 counterspell Fluffy_Pillow 520360.5/1155000: 45% mana heating_up, pyretic_incantation
3:10.537 dragons_breath Fluffy_Pillow 498360.5/1155000: 43% mana heating_up, pyretic_incantation
3:11.836 fireball Fluffy_Pillow 475794.0/1155000: 41% mana enhanced_pyrotechnics
3:13.609 fireball Fluffy_Pillow 483048.5/1155000: 42% mana enhanced_pyrotechnics
3:15.382 fire_blast Fluffy_Pillow 490303.0/1155000: 42% mana heating_up, pyretic_incantation
3:15.382 pyroblast Fluffy_Pillow 479303.0/1155000: 41% mana hot_streak, pyretic_incantation(2)
3:16.682 fire_blast Fluffy_Pillow 473253.0/1155000: 41% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:16.682 fireball Fluffy_Pillow 462253.0/1155000: 40% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:18.455 pyroblast Fluffy_Pillow 469507.5/1155000: 41% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:19.755 fireball Fluffy_Pillow 463457.5/1155000: 40% mana heating_up
3:21.528 fireball Fluffy_Pillow 470712.0/1155000: 41% mana heating_up
3:23.301 phoenixs_flames Fluffy_Pillow 477966.5/1155000: 41% mana enhanced_pyrotechnics
3:24.600 pyroblast Fluffy_Pillow 499400.0/1155000: 43% mana hot_streak, pyretic_incantation(2)
3:25.900 fire_blast Fluffy_Pillow 493350.0/1155000: 43% mana heating_up, pyretic_incantation(3)
3:25.900 fireball Fluffy_Pillow 482350.0/1155000: 42% mana hot_streak, pyretic_incantation(4)
3:27.673 pyroblast Fluffy_Pillow 489604.5/1155000: 42% mana hot_streak, pyretic_incantation(4)
3:28.972 fireball Fluffy_Pillow 483538.0/1155000: 42% mana hot_streak, pyretic_incantation(5)
3:30.745 pyroblast Fluffy_Pillow 490792.5/1155000: 42% mana hot_streak, pyretic_incantation(5)
3:32.046 dragons_breath Fluffy_Pillow 484759.0/1155000: 42% mana heating_up
3:33.346 fireball Fluffy_Pillow 462209.0/1155000: 40% mana heating_up
3:35.117 fireball Fluffy_Pillow 469430.5/1155000: 41% mana heating_up
3:36.890 fireball Fluffy_Pillow 476685.0/1155000: 41% mana enhanced_pyrotechnics
3:38.663 fireball Fluffy_Pillow 483939.5/1155000: 42% mana enhanced_pyrotechnics(2)
3:40.435 fire_blast Fluffy_Pillow 491177.5/1155000: 43% mana heating_up, pyretic_incantation
3:40.435 pyroblast Fluffy_Pillow 480177.5/1155000: 42% mana hot_streak, pyretic_incantation(2)
3:41.735 fireball Fluffy_Pillow 474127.5/1155000: 41% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:43.508 fireball Fluffy_Pillow 481382.0/1155000: 42% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:45.281 pyroblast Fluffy_Pillow 488636.5/1155000: 42% mana hot_streak, pyretic_incantation(2)
3:46.581 fireball Fluffy_Pillow 482586.5/1155000: 42% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:48.353 fireball Fluffy_Pillow 489824.5/1155000: 42% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:50.127 pyroblast Fluffy_Pillow 497095.5/1155000: 43% mana hot_streak, pyretic_incantation(2)
3:51.425 fireball Fluffy_Pillow 491012.5/1155000: 43% mana hot_streak, pyretic_incantation(4)
3:53.198 pyroblast Fluffy_Pillow 498267.0/1155000: 43% mana hot_streak, pyretic_incantation(4)
3:54.496 dragons_breath Fluffy_Pillow 492184.0/1155000: 43% mana hot_streak, pyretic_incantation(5)
3:55.793 pyroblast Fluffy_Pillow 469584.5/1155000: 41% mana hot_streak, pyretic_incantation(5)
3:57.092 fireball Fluffy_Pillow 463518.0/1155000: 40% mana
3:58.864 fireball Fluffy_Pillow 470756.0/1155000: 41% mana
4:00.638 mirror_image Fluffy_Pillow 478027.0/1155000: 41% mana enhanced_pyrotechnics
4:01.937 combustion Fluffy_Pillow 477460.5/1155000: 41% mana heating_up, pyretic_incantation
4:01.937 meteor Fluffy_Pillow 367460.5/1155000: 32% mana combustion, heating_up, pyretic_incantation
4:03.237 fire_blast Fluffy_Pillow 377910.5/1155000: 33% mana combustion, heating_up, pyretic_incantation
4:03.237 pyroblast Fluffy_Pillow 366910.5/1155000: 32% mana combustion, hot_streak, pyretic_incantation(2)
4:04.537 fire_blast Fluffy_Pillow 360860.5/1155000: 31% mana combustion, heating_up, pyretic_incantation(3)
4:04.537 flame_on Fluffy_Pillow 349860.5/1155000: 30% mana combustion, hot_streak, pyretic_incantation(4)
4:04.537 pyroblast Fluffy_Pillow 349860.5/1155000: 30% mana combustion, hot_streak, pyretic_incantation(4)
4:05.837 pyroblast Fluffy_Pillow 343810.5/1155000: 30% mana combustion, hot_streak, pyretic_incantation(5)
4:07.137 fire_blast Fluffy_Pillow 337760.5/1155000: 29% mana combustion, heating_up, pyretic_incantation(5)
4:07.137 pyroblast Fluffy_Pillow 326760.5/1155000: 28% mana combustion, hot_streak, pyretic_incantation(5)
4:08.437 fire_blast Fluffy_Pillow 320710.5/1155000: 28% mana combustion, heating_up, pyretic_incantation(5)
4:08.437 pyroblast Fluffy_Pillow 309710.5/1155000: 27% mana combustion, hot_streak, pyretic_incantation(5)
4:09.735 phoenixs_flames Fluffy_Pillow 303627.5/1155000: 26% mana combustion, heating_up, pyretic_incantation(5)
4:11.035 pyroblast Fluffy_Pillow 325077.5/1155000: 28% mana combustion, hot_streak, pyretic_incantation(5)
4:12.334 phoenixs_flames Fluffy_Pillow 319011.0/1155000: 28% mana heating_up, pyretic_incantation(5)
4:13.633 pyroblast Fluffy_Pillow 340444.5/1155000: 29% mana hot_streak, pyretic_incantation(5)
4:14.932 dragons_breath Fluffy_Pillow 334378.0/1155000: 29% mana heating_up, pyretic_incantation(5)
4:16.230 fireball Fluffy_Pillow 311795.0/1155000: 27% mana heating_up, pyretic_incantation(5)
4:18.002 fire_blast Fluffy_Pillow 319033.0/1155000: 28% mana heating_up, pyretic_incantation(5)
4:18.002 pyroblast Fluffy_Pillow 308033.0/1155000: 27% mana hot_streak, pyretic_incantation(5)
4:19.301 fireball Fluffy_Pillow 301966.5/1155000: 26% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:21.073 fireball Fluffy_Pillow 309204.5/1155000: 27% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:22.847 pyroblast Fluffy_Pillow 316475.5/1155000: 27% mana hot_streak, pyretic_incantation(2)
4:24.147 counterspell Fluffy_Pillow 310425.5/1155000: 27% mana hot_streak, pyretic_incantation(4)
4:24.147 phoenixs_flames Fluffy_Pillow 288425.5/1155000: 25% mana hot_streak, pyretic_incantation(4)
4:25.447 pyroblast Fluffy_Pillow 309875.5/1155000: 27% mana hot_streak, pyretic_incantation(5)
4:26.747 fireball Fluffy_Pillow 303825.5/1155000: 26% mana heating_up, pyretic_incantation(5)
4:28.519 fire_blast Fluffy_Pillow 311063.5/1155000: 27% mana heating_up, pyretic_incantation(5)
4:28.519 pyroblast Fluffy_Pillow 300063.5/1155000: 26% mana hot_streak, pyretic_incantation(5)
4:29.820 fireball Fluffy_Pillow 294030.0/1155000: 25% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:31.593 fireball Fluffy_Pillow 301284.5/1155000: 26% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:33.366 pyroblast Fluffy_Pillow 308539.0/1155000: 27% mana hot_streak, pyretic_incantation(2)
4:34.667 phoenixs_flames Fluffy_Pillow 302505.5/1155000: 26% mana hot_streak, pyretic_incantation(4)
4:35.965 pyroblast Fluffy_Pillow 323922.5/1155000: 28% mana hot_streak, pyretic_incantation(5)
4:37.265 dragons_breath Fluffy_Pillow 317872.5/1155000: 28% mana
4:38.565 fireball Fluffy_Pillow 295322.5/1155000: 26% mana
4:40.337 fireball Fluffy_Pillow 302560.5/1155000: 26% mana
4:42.110 fire_blast Fluffy_Pillow 309815.0/1155000: 27% mana heating_up, pyretic_incantation
4:42.110 pyroblast Fluffy_Pillow 298815.0/1155000: 26% mana hot_streak, pyretic_incantation(2)
4:43.409 fireball Fluffy_Pillow 292748.5/1155000: 25% mana heating_up
4:45.181 fireball Fluffy_Pillow 299986.5/1155000: 26% mana heating_up
4:46.954 pyroblast Fluffy_Pillow 307241.0/1155000: 27% mana hot_streak, pyretic_incantation
4:48.253 meteor Fluffy_Pillow 301174.5/1155000: 26% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:49.552 fire_blast Fluffy_Pillow 311608.0/1155000: 27% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:49.552 pyroblast Fluffy_Pillow 300608.0/1155000: 26% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:50.851 flame_on Fluffy_Pillow 294541.5/1155000: 26% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
4:50.851 fire_blast Fluffy_Pillow 294541.5/1155000: 26% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
4:50.851 fireball Fluffy_Pillow 283541.5/1155000: 25% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4)
4:52.624 pyroblast Fluffy_Pillow 290796.0/1155000: 25% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4)
4:53.925 fireball Fluffy_Pillow 284762.5/1155000: 25% mana hot_streak, pyretic_incantation(5)
4:55.697 pyroblast Fluffy_Pillow 292000.5/1155000: 25% mana hot_streak, pyretic_incantation(5)
4:56.998 phoenixs_flames Fluffy_Pillow 285967.0/1155000: 25% mana hot_streak, pyretic_incantation(5)
4:58.530 pyroblast Fluffy_Pillow 311245.0/1155000: 27% mana hot_streak, pyretic_incantation(5)
4:59.829 dragons_breath Fluffy_Pillow 305178.5/1155000: 26% mana heating_up, pyretic_incantation(5)
5:01.129 counterspell Fluffy_Pillow 282628.5/1155000: 24% mana heating_up, pyretic_incantation(5)
5:01.129 fire_blast Fluffy_Pillow 260628.5/1155000: 23% mana heating_up, pyretic_incantation(5)
5:01.129 pyroblast Fluffy_Pillow 249628.5/1155000: 22% mana hot_streak, pyretic_incantation(5)
5:02.428 fireball Fluffy_Pillow 243562.0/1155000: 21% mana
5:04.201 fireball Fluffy_Pillow 250816.5/1155000: 22% mana
5:05.973 fire_blast Fluffy_Pillow 258054.5/1155000: 22% mana heating_up, pyretic_incantation
5:05.973 pyroblast Fluffy_Pillow 247054.5/1155000: 21% mana hot_streak, pyretic_incantation(2)
5:07.275 fireball Fluffy_Pillow 241037.5/1155000: 21% mana heating_up
5:09.048 fireball Fluffy_Pillow 248292.0/1155000: 21% mana heating_up
5:10.820 fireball Fluffy_Pillow 255530.0/1155000: 22% mana enhanced_pyrotechnics
5:12.594 fire_blast Fluffy_Pillow 262801.0/1155000: 23% mana heating_up, pyretic_incantation
5:12.594 pyroblast Fluffy_Pillow 251801.0/1155000: 22% mana hot_streak, pyretic_incantation(2)
5:13.893 fireball Fluffy_Pillow 245734.5/1155000: 21% mana enhanced_pyrotechnics
5:15.667 fireball Fluffy_Pillow 253005.5/1155000: 22% mana enhanced_pyrotechnics
5:17.440 fireball Fluffy_Pillow 260260.0/1155000: 23% mana heating_up, pyretic_incantation
5:19.212 fireball Fluffy_Pillow 267498.0/1155000: 23% mana enhanced_pyrotechnics
5:20.984 dragons_breath Fluffy_Pillow 274736.0/1155000: 24% mana heating_up, pyretic_incantation
5:22.283 fireball Fluffy_Pillow 252169.5/1155000: 22% mana enhanced_pyrotechnics
5:24.056 fireball Fluffy_Pillow 259424.0/1155000: 22% mana enhanced_pyrotechnics
5:25.829 fire_blast Fluffy_Pillow 266678.5/1155000: 23% mana heating_up, pyretic_incantation
5:25.829 pyroblast Fluffy_Pillow 255678.5/1155000: 22% mana hot_streak, pyretic_incantation(2)
5:27.127 fireball Fluffy_Pillow 249595.5/1155000: 22% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:28.899 fireball Fluffy_Pillow 256833.5/1155000: 22% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:30.672 pyroblast Fluffy_Pillow 264088.0/1155000: 23% mana hot_streak, pyretic_incantation(2)
5:31.972 fireball Fluffy_Pillow 258038.0/1155000: 22% mana hot_streak, pyretic_incantation(4)
5:33.745 pyroblast Fluffy_Pillow 265292.5/1155000: 23% mana hot_streak, pyretic_incantation(4)
5:35.042 fire_blast Fluffy_Pillow 259193.0/1155000: 22% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:35.042 fireball Fluffy_Pillow 248193.0/1155000: 21% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:36.815 pyroblast Fluffy_Pillow 255447.5/1155000: 22% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:38.115 counterspell Fluffy_Pillow 249397.5/1155000: 22% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
5:38.115 fireball Fluffy_Pillow 227397.5/1155000: 20% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
5:39.889 fireball Fluffy_Pillow 234668.5/1155000: 20% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
5:41.663 pyroblast Fluffy_Pillow 241939.5/1155000: 21% mana hot_streak, pyretic_incantation(2)
5:42.964 dragons_breath Fluffy_Pillow 235906.0/1155000: 20% mana hot_streak
5:44.263 pyroblast Fluffy_Pillow 213339.5/1155000: 18% mana hot_streak, pyretic_incantation
5:45.562 fire_blast Fluffy_Pillow 207273.0/1155000: 18% mana heating_up, pyretic_incantation(2)
5:45.562 fireball Fluffy_Pillow 196273.0/1155000: 17% mana hot_streak, pyretic_incantation(3)
5:47.334 pyroblast Fluffy_Pillow 203511.0/1155000: 18% mana hot_streak, pyretic_incantation(3)
5:48.634 fireball Fluffy_Pillow 197461.0/1155000: 17% mana hot_streak, pyretic_incantation(5)
5:50.407 pyroblast Fluffy_Pillow 204715.5/1155000: 18% mana hot_streak, pyretic_incantation(5)
5:51.707 fireball Fluffy_Pillow 198665.5/1155000: 17% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:53.480 fireball Fluffy_Pillow 205920.0/1155000: 18% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:55.253 pyroblast Fluffy_Pillow 213174.5/1155000: 18% mana hot_streak, pyretic_incantation(2)
5:56.552 fireball Fluffy_Pillow 207108.0/1155000: 18% mana hot_streak, pyretic_incantation(4)
5:58.324 pyroblast Fluffy_Pillow 214346.0/1155000: 19% mana hot_streak, pyretic_incantation(4)
5:59.623 fireball Fluffy_Pillow 208279.5/1155000: 18% mana hot_streak, pyretic_incantation(5)
6:01.395 mirror_image Fluffy_Pillow 215517.5/1155000: 19% mana hot_streak, pyretic_incantation(5)
6:02.695 combustion Fluffy_Pillow 214967.5/1155000: 19% mana hot_streak, pyretic_incantation(5)
6:02.695 meteor Fluffy_Pillow 104967.5/1155000: 9% mana combustion, hot_streak, pyretic_incantation(5)
6:03.995 dragons_breath Fluffy_Pillow 115417.5/1155000: 10% mana combustion, hot_streak, pyretic_incantation(5)
6:05.296 pyroblast Fluffy_Pillow 92884.0/1155000: 8% mana combustion, hot_streak, pyretic_incantation(5)
6:06.596 fire_blast Fluffy_Pillow 86834.0/1155000: 8% mana combustion, heating_up, pyretic_incantation(5)
6:06.596 pyroblast Fluffy_Pillow 75834.0/1155000: 7% mana combustion, hot_streak, pyretic_incantation(5)
6:07.895 fire_blast Fluffy_Pillow 69767.5/1155000: 6% mana combustion, heating_up, pyretic_incantation(5)
6:07.895 flame_on Fluffy_Pillow 58767.5/1155000: 5% mana combustion, hot_streak, pyretic_incantation(5)
6:07.895 pyroblast Fluffy_Pillow 58767.5/1155000: 5% mana combustion, hot_streak, pyretic_incantation(5)
6:09.193 fire_blast Fluffy_Pillow 52684.5/1155000: 5% mana combustion, heating_up, pyretic_incantation(5)
6:09.193 pyroblast Fluffy_Pillow 41684.5/1155000: 4% mana combustion, hot_streak, pyretic_incantation(5)
6:10.492 fire_blast Fluffy_Pillow 35618.0/1155000: 3% mana combustion, heating_up, pyretic_incantation(5)
6:10.492 phoenixs_flames Fluffy_Pillow 24618.0/1155000: 2% mana combustion, hot_streak, pyretic_incantation(5)
6:11.792 pyroblast Fluffy_Pillow 46068.0/1155000: 4% mana combustion, hot_streak, pyretic_incantation(5)
6:13.090 phoenixs_flames Fluffy_Pillow 39985.0/1155000: 3% mana heating_up, pyretic_incantation(5)
6:14.390 pyroblast Fluffy_Pillow 61435.0/1155000: 5% mana hot_streak, pyretic_incantation(5)
6:15.689 counterspell Fluffy_Pillow 55368.5/1155000: 5% mana heating_up, pyretic_incantation(5)
6:15.689 phoenixs_flames Fluffy_Pillow 33368.5/1155000: 3% mana heating_up, pyretic_incantation(5)
6:16.987 pyroblast Fluffy_Pillow 54785.5/1155000: 5% mana hot_streak, pyretic_incantation(5)
6:18.288 fireball Fluffy_Pillow 48752.0/1155000: 4% mana
6:20.061 fireball Fluffy_Pillow 56006.5/1155000: 5% mana
6:21.832 fireball Fluffy_Pillow 63228.0/1155000: 5% mana enhanced_pyrotechnics
6:23.604 fire_blast Fluffy_Pillow 70466.0/1155000: 6% mana heating_up, pyretic_incantation
6:23.604 pyroblast Fluffy_Pillow 59466.0/1155000: 5% mana hot_streak, pyretic_incantation(2)
6:24.904 dragons_breath Fluffy_Pillow 53416.0/1155000: 5% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:26.203 fireball Fluffy_Pillow 30849.5/1155000: 3% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(2)
6:27.976 fireball Fluffy_Pillow 38104.0/1155000: 3% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(2)
6:29.749 fireball Fluffy_Pillow 45358.5/1155000: 4% mana enhanced_pyrotechnics(2)
6:31.521 fire_blast Fluffy_Pillow 52596.5/1155000: 5% mana heating_up, pyretic_incantation
6:31.521 pyroblast Fluffy_Pillow 41596.5/1155000: 4% mana hot_streak, pyretic_incantation(2)
6:32.822 fireball Fluffy_Pillow 35563.0/1155000: 3% mana enhanced_pyrotechnics, hot_streak
6:34.594 pyroblast Fluffy_Pillow 42801.0/1155000: 4% mana enhanced_pyrotechnics, hot_streak
6:35.894 fireball Fluffy_Pillow 36751.0/1155000: 3% mana heating_up
6:37.665 fireball Fluffy_Pillow 43972.5/1155000: 4% mana heating_up
6:39.436 pyroblast Fluffy_Pillow 51194.0/1155000: 4% mana hot_streak, pyretic_incantation
6:40.733 fireball Fluffy_Pillow 45094.5/1155000: 4% mana hot_streak, pyretic_incantation(3)
6:42.504 pyroblast Fluffy_Pillow 52316.0/1155000: 5% mana hot_streak, pyretic_incantation(3)
6:43.805 fire_blast Fluffy_Pillow 46282.5/1155000: 4% mana heating_up
6:43.805 fireball Fluffy_Pillow 35282.5/1155000: 3% mana hot_streak, pyretic_incantation
6:45.577 pyroblast Fluffy_Pillow 42520.5/1155000: 4% mana hot_streak, pyretic_incantation
6:46.876 fireball Fluffy_Pillow 36454.0/1155000: 3% mana enhanced_pyrotechnics
6:48.648 meteor Fluffy_Pillow 43692.0/1155000: 4% mana enhanced_pyrotechnics
6:49.947 dragons_breath Fluffy_Pillow 54125.5/1155000: 5% mana heating_up, pyretic_incantation
6:51.247 fire_blast Fluffy_Pillow 31575.5/1155000: 3% mana heating_up
6:51.247 Waiting 0.100 sec 20575.5/1155000: 2% mana hot_streak, pyretic_incantation
6:51.347 fireball Fluffy_Pillow 22225.5/1155000: 2% mana hot_streak, pyretic_incantation
6:53.119 counterspell Fluffy_Pillow 29463.5/1155000: 3% mana hot_streak, pyretic_incantation
6:53.119 flame_on Fluffy_Pillow 7463.5/1155000: 1% mana hot_streak, pyretic_incantation
6:53.119 phoenixs_flames Fluffy_Pillow 7463.5/1155000: 1% mana hot_streak, pyretic_incantation
6:54.417 pyroblast Fluffy_Pillow 28880.5/1155000: 3% mana hot_streak, pyretic_incantation(3)
6:55.716 fire_blast Fluffy_Pillow 22814.0/1155000: 2% mana heating_up, pyretic_incantation(4)
6:55.716 Waiting 0.700 sec 11814.0/1155000: 1% mana hot_streak, pyretic_incantation(5)
6:56.416 fireball Fluffy_Pillow 23364.0/1155000: 2% mana hot_streak, pyretic_incantation(5)
6:58.188 pyroblast Fluffy_Pillow 30602.0/1155000: 3% mana hot_streak, pyretic_incantation(5)
6:59.490 fire_blast Fluffy_Pillow 24585.0/1155000: 2% mana heating_up
6:59.490 Waiting 0.600 sec 13585.0/1155000: 1% mana hot_streak, pyretic_incantation
7:00.090 fireball Fluffy_Pillow 23485.0/1155000: 2% mana hot_streak, pyretic_incantation
7:01.861 pyroblast Fluffy_Pillow 30706.5/1155000: 3% mana hot_streak, pyretic_incantation
7:03.160 fireball Fluffy_Pillow 24640.0/1155000: 2% mana hot_streak, pyretic_incantation(3)
7:04.932 pyroblast Fluffy_Pillow 31878.0/1155000: 3% mana hot_streak, pyretic_incantation(3)
7:06.232 fireball Fluffy_Pillow 25828.0/1155000: 2% mana hot_streak, pyretic_incantation(5)
7:08.006 pyroblast Fluffy_Pillow 33099.0/1155000: 3% mana hot_streak, pyretic_incantation(5)
7:09.307 fireball Fluffy_Pillow 27065.5/1155000: 2% mana enhanced_pyrotechnics
7:11.078 fireball Fluffy_Pillow 34287.0/1155000: 3% mana enhanced_pyrotechnics
7:12.850 fire_blast Fluffy_Pillow 41525.0/1155000: 4% mana heating_up, pyretic_incantation
7:12.850 pyroblast Fluffy_Pillow 30525.0/1155000: 3% mana hot_streak, pyretic_incantation(2)
7:14.151 phoenixs_flames Fluffy_Pillow 24491.5/1155000: 2% mana enhanced_pyrotechnics, hot_streak
7:15.452 pyroblast Fluffy_Pillow 45958.0/1155000: 4% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
7:16.752 fireball Fluffy_Pillow 39908.0/1155000: 3% mana enhanced_pyrotechnics
7:18.524 dragons_breath Fluffy_Pillow 47146.0/1155000: 4% mana enhanced_pyrotechnics
7:19.823 fireball Fluffy_Pillow 24579.5/1155000: 2% mana enhanced_pyrotechnics(2)
7:21.596 fireball Fluffy_Pillow 31834.0/1155000: 3% mana enhanced_pyrotechnics(2)
7:23.370 fire_blast Fluffy_Pillow 39105.0/1155000: 3% mana heating_up, pyretic_incantation
7:23.370 pyroblast Fluffy_Pillow 28105.0/1155000: 2% mana hot_streak, pyretic_incantation(2)
7:24.669 fireball Fluffy_Pillow 22038.5/1155000: 2% mana enhanced_pyrotechnics
7:26.442 fireball Fluffy_Pillow 29293.0/1155000: 3% mana enhanced_pyrotechnics
7:28.214 fire_blast Fluffy_Pillow 36531.0/1155000: 3% mana heating_up, pyretic_incantation
7:28.214 fireball Fluffy_Pillow 25531.0/1155000: 2% mana hot_streak, pyretic_incantation(2)
7:29.986 counterspell Fluffy_Pillow 32769.0/1155000: 3% mana enhanced_pyrotechnics, hot_streak
7:29.986 Waiting 0.700 sec 10769.0/1155000: 1% mana enhanced_pyrotechnics, hot_streak
7:30.686 fireball Fluffy_Pillow 22319.0/1155000: 2% mana enhanced_pyrotechnics, hot_streak
7:32.459 pyroblast Fluffy_Pillow 29573.5/1155000: 3% mana hot_streak, pyretic_incantation

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4870 4545 0
Agility 6579 6254 0
Stamina 31066 31066 19576
Intellect 31826 30119 21355 (605)
Spirit 0 0 0
Health 1863960 1863960 0
Mana 1155000 1155000 0
Spell Power 31826 30119 0
Melee Crit 33.83% 32.76% 9715
Spell Crit 53.83% 37.76% 9715
Haste 15.80% 15.80% 4761
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 16500 16500 0
Mastery 13.64% 13.64% 3567
Armor 1635 1635 1635
Run Speed 7 0 314

Gear

Source Slot Average Item Level: 847.00
Local Head Darckli's Dragonfire Diadem
ilevel: 895, stats: { 248 Armor, +2959 Sta, +1973 Int, +993 Crit, +552 Haste }
Local Neck Chain of the Underking
ilevel: 825, stats: { +867 Sta, +1003 Crit, +668 Mastery, +287 Avoidance }, enchant: { +75 Haste }
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 850, stats: { 195 Armor, +1459 Sta, +973 Int, +574 Mastery, +406 Crit }
Local Shirt Precious' Ribbon
ilevel: 1
Local Chest Tunic of Smoldering Ire
ilevel: 845, stats: { 256 Armor, +1238 Int, +1857 Sta, +915 Crit, +366 Mastery }
Local Waist Imbued Silkweave Cinch of the Fireflash
ilevel: 850, stats: { 146 Armor, +1459 Sta, +973 Int, +490 Crit, +490 Haste }
Local Legs Legwraps of Reverberating Shadows
ilevel: 850, stats: { 228 Armor, +1297 Int, +1945 Sta, +792 Haste, +512 Crit }
Local Feet Mistbound Helarjar Footwraps
ilevel: 845, stats: { 176 Armor, +1393 Sta, +929 Int, +563 Haste, +398 Crit }
Local Wrists Night Dreamer Bindings
ilevel: 835, stats: { 108 Armor, +635 Int, +952 Sta, +481 Haste, +213 Mastery }
Local Hands Gloves of Tirisgarde
ilevel: 840, stats: { 157 Armor, +1329 Sta, +886 Int, +552 Crit, +391 Haste }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 RunSpeed }
Local Finger2 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Crit }
Local Trinket1 Bloom of New Growth
ilevel: 830, stats: { +1023 Int, +865 Crit }
Local Trinket2 Nightborne Researcher's Phial
ilevel: 830, stats: { +1023 Int, +865 Crit }
Local Back Stormsky Greatcloak
ilevel: 830, stats: { 121 Armor, +605 StrAgiInt, +908 Sta, +413 Crit, +268 Mastery }
Local Main Hand Felo'melorn
ilevel: 867, weapon: { 1930 - 3586, 2.6 }, stats: { +652 Int, +977 Sta, +298 Haste, +298 Mastery, +8293 Int }, relics: { +40 ilevels, +37 ilevels, +40 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 867, stats: { +855 Int, +1283 Sta, +542 Haste, +240 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Lâstykökö"
origin="https://eu.api.battle.net/wow/character/hyjal/Lâstykökö/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/105/115117161-avatar.jpg"
level=110
race=gnome
role=spell
position=back
professions=tailoring=797/inscription=727
talents=http://eu.battle.net/wow/en/tool/talent-calculator#eZ!0101012
artifact=54:0:0:0:0:748:1:749:3:751:3:752:2:754:3:755:3:756:3:759:1:762:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=target.health.pct<25|time=0
actions+=/shard_of_the_exodar_warp,if=buff.bloodlust.down
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=darcklis_dragonfire_diadem,id=132863,bonus_id=1811
neck=chain_of_the_underking,id=134495,bonus_id=1726/40/1477,enchant=75haste
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1807/1472
back=stormsky_greatcloak,id=134202,bonus_id=3397/1492/1675
chest=tunic_of_smoldering_ire,id=137352,bonus_id=1727/1497/3336
shirt=precious_ribbon,id=52019
tabard=renowned_guild_tabard,id=69210
wrists=night_dreamer_bindings,id=139092,bonus_id=3397/1497/3336
hands=gloves_of_tirisgarde,id=139748,bonus_id=3386/3384
waist=imbued_silkweave_cinch,id=127001,bonus_id=689/1693/3408/600/669
legs=legwraps_of_reverberating_shadows,id=137404,bonus_id=3410/1502/3336
feet=mistbound_helarjar_footwraps,id=133608,bonus_id=1726/1497/3337
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/42/1472
finger2=empowered_ring_of_the_kirin_tor,id=139599,enchant=150crit
trinket1=bloom_of_new_growth,id=139076,bonus_id=3396/603/1492/3339
trinket2=nightborne_researchers_phial,id=134292,bonus_id=3397/603/1492/1675
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=137358/137547/136769/0,relic_id=1727:1492:1813/1726:1482:3339/1727:1492:1813/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=847.44
# gear_stamina=19576
# gear_intellect=21355
# gear_crit_rating=9715
# gear_haste_rating=4761
# gear_mastery_rating=3567
# gear_speed_rating=314
# gear_avoidance_rating=287
# gear_armor=1635

Malikoom

Malikoom : 212761 dps

  • Race: Pandaren Alliance
  • Class: Monk
  • Spec: Windwalker
  • Level: 110
  • Role: Dps
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
212761.1 212761.1 87.8 / 0.041% 17582.7 / 8.3% 13400.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.7 12.7 Energy 14.49% 42.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Malikoom/advanced
Talents
  • 15: Eye of the Tiger
  • 30: Celerity
  • 45: Energizing Elixir (Windwalker Monk)
  • 60: Leg Sweep
  • 75: Healing Elixir
  • 90: Hit Combo (Windwalker Monk)
  • 100: Whirling Dragon Punch (Windwalker Monk)
  • Talent Calculator
Artifact
Professions
  • mining: 669
  • jewelcrafting: 391

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Malikoom 212761
Blackout Kick 25898 12.2% 86.5 5.10sec 134928 134324 Direct 86.5 108339 216794 134929 24.5% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.53 86.53 0.00 0.00 1.0045 0.0000 11675614.98 17164259.96 31.98 134324.44 134324.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.32 75.48% 108339.37 58173 118387 108287.37 100848 117226 7076529 10403167 31.98
crit 21.21 24.52% 216794.11 116346 236774 216678.51 167715 236774 4599086 6761093 31.98
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!prev_gcd.blackout_kick
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Crackling Jade Lightning 27 0.0% 0.8 143.37sec 14896 7579 Periodic 1.6 5959 11930 7460 25.1% 0.0% 0.3%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.80 0.00 1.61 1.61 1.9662 0.8599 11989.50 11989.50 0.00 7578.70 7578.70
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.2 74.85% 5958.85 3297 6594 3204.05 0 6594 7168 7168 0.00
crit 0.4 25.15% 11929.98 6594 13188 3588.61 0 13188 4821 4821 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 39147 18.4% 21.5 21.29sec 819418 229861 Periodic 107.2 132125 264568 164512 24.5% 0.0% 15.8%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.53 0.00 107.22 107.22 3.5649 0.6651 17639736.84 25932084.04 31.98 229860.66 229860.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.0 75.55% 132124.54 70687 154711 132036.29 122258 141890 10702493 15733679 31.98
crit 26.2 24.45% 264567.96 141374 309423 264391.57 200263 309423 6937244 10198405 31.98
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:5.250000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee_main_hand 6620 3.1% 167.4 2.71sec 17817 8215 Direct 167.4 16880 33763 17817 24.6% 19.0%  

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.42 167.42 0.00 0.00 2.1689 0.0000 2982953.20 4385223.76 31.98 8214.85 8214.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.43 56.40% 16879.63 8720 18731 16870.95 15698 18031 1593890 2343169 31.98
crit 41.14 24.57% 33762.83 17439 37462 33747.76 28433 37265 1389063 2042055 31.98
miss 31.85 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_off_hand 3288 1.5% 166.4 2.71sec 8904 4094 Direct 166.4 8442 16883 8904 24.5% 19.0%  

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.42 166.42 0.00 0.00 2.1752 0.0000 1481866.95 2178484.78 31.98 4093.58 4093.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.95 56.45% 8442.32 4360 9365 8437.78 7862 8926 793157 1166017 31.98
crit 40.79 24.51% 16883.46 8720 18731 16874.61 14224 18731 688709 1012468 31.98
miss 31.68 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Pepper Breath 3802 1.8% 20.3 21.73sec 84241 0 Periodic 100.9 16968 0 16968 0.0% 0.0% 5.6%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 0.00 101.26 100.91 0.0000 0.2497 1712146.96 1712146.96 0.00 67724.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.9 100.00% 16967.55 68 16990 16968.64 16594 16990 1712147 1712147 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.7500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 5495 2.5% 19.8 7.66sec 123292 0 Direct 19.8 98885 197842 123295 24.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.76 19.76 0.00 0.00 0.0000 0.0000 2436511.24 3581902.31 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.89 75.34% 98884.94 65797 141342 98840.05 69895 126111 1472153 2164205 31.98
crit 4.87 24.66% 197842.13 131594 282683 196956.66 0 282683 964358 1417697 31.85
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rising Sun Kick 29096 13.7% 43.5 10.31sec 301282 299938 Direct 43.5 241939 484211 301281 24.5% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.53 43.53 0.00 0.00 1.0045 0.0000 13114181.98 19279089.72 31.98 299937.84 299937.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.87 75.51% 241938.70 127147 268164 241775.85 215396 264101 7951518 11689485 31.98
crit 10.66 24.49% 484210.78 254294 536328 483810.73 268164 536328 5162664 7589605 31.98
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 12023 (18050) 5.7% (8.5%) 11.4 41.35sec 715558 475637 Direct 11.4 383038 766826 476575 24.4% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.38 11.38 0.00 0.00 1.5045 0.0000 5421940.64 7970766.32 31.98 475637.05 475637.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.60 75.63% 383038.17 235813 526045 382280.82 253953 526045 3295789 4845122 31.98
crit 2.77 24.37% 766825.77 471626 1052090 731767.97 0 1052090 2126152 3125645 30.54
 
 

Action details: strike_of_the_windlord

Static Values
  • id:205320
  • school:physical
  • resource:chi
  • range:9.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205320
  • name:Strike of the Windlord
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
    Strike of the Windlord (_offhand) 6027 2.8% 0.0 0.00sec 0 0 Direct 11.4 191509 383466 238991 24.7% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.38 0.00 0.00 0.0000 0.0000 2719063.15 3997280.39 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.56 75.26% 191509.41 117907 263022 191183.85 124709 263022 1639802 2410664 31.98
crit 2.81 24.74% 383466.22 235813 526045 364779.25 0 526045 1079262 1586617 30.50
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 7677 (13106) 3.6% (6.2%) 114.7 3.90sec 51519 51288 Direct 114.7 24213 48453 30174 24.6% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.67 114.67 0.00 0.00 1.0045 0.0000 3460165.75 5086771.41 31.98 51288.32 51288.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.47 75.41% 24212.73 12526 26907 24200.06 22536 25562 2093722 3077969 31.98
crit 28.20 24.59% 48452.79 25052 53814 48426.66 38114 53814 1366444 2008802 31.98
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!prev_gcd.tiger_palm
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Eye of the Tiger (_damage) 5429 2.6% 114.7 3.90sec 21345 0 Periodic 222.4 11005 0 11005 0.0% 0.0% 98.5%

Stats details: eye_of_the_tiger_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.67 0.00 222.41 222.41 0.0000 1.9962 2447684.84 2447684.84 0.00 5513.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 222.4 100.00% 11005.37 3 12213 11000.75 10704 11214 2447685 2447685 0.00
 
 

Action details: eye_of_the_tiger_damage

Static Values
  • id:196608
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196608
  • name:Eye of the Tiger
  • school:nature
  • tooltip:$?$w1>0[Healing $w1 every $t1 sec.][Suffering $w2 Nature damage every $t2 sec.]
  • description:{$@spelldesc196607=Tiger Palm also applies Eye of the Tiger, dealing $196608o2 Nature damage to the enemy and $196608o1 healing to the Monk over {$196608d=8 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.430000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Touch of Death 9964 4.7% 4.3 120.42sec 1039309 1034805 Periodic 4.2 1062068 0 1062068 0.0% 0.0% 7.5%

Stats details: touch_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 4.22 4.22 1.0045 8.0000 4481738.96 0.00 0.00 117661.83 1034804.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.2 100.00% 1062068.25 1062068 1062068 1062068.25 1062068 1062068 4481739 0 0.00
 
 

Action details: touch_of_death

Static Values
  • id:115080
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
Spelldata
  • id:115080
  • name:Touch of Death
  • school:physical
  • tooltip:Taking $w1 damage when this effect expires.
  • description:Use ancient Pandaren knowledge of anatomy to inflict mortal damage on an enemy. After {$d=8 seconds}, the target will take damage equal to your maximum health, reduced against players.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:8.00
  • base_tick_time:8.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Whirling Dragon Punch 16085 7.6% 21.2 21.37sec 341598 195282 Periodic 63.6 91532 183146 113985 24.5% 0.0% 2.9%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.22 0.00 63.58 63.58 1.7493 0.2080 7247486.84 10654492.16 31.98 195281.62 195281.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.0 75.49% 91531.98 51338 106343 91481.12 82609 100564 4393668 6459107 31.98
crit 15.6 24.51% 183145.56 102676 212686 183066.41 137513 212686 2853819 4195385 31.98
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - fire_spirit 101495 / 21085
auto_attack_mh 4512 0.4% 41.3 10.17sec 10181 4968 Direct 41.3 9665 19327 10182 24.5% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.25 41.25 0.00 0.00 2.0492 0.0000 420002.93 617444.08 31.98 4968.45 4968.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.28 56.44% 9665.09 8731 10128 9665.33 9342 9954 225042 330833 31.98
crit 10.09 24.45% 19326.72 17462 20256 19326.95 18277 20256 194961 286611 31.98
miss 7.88 19.10% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2259 0.2% 41.3 10.17sec 5098 2488 Direct 41.3 4832 9665 5098 24.5% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.25 41.25 0.00 0.00 2.0492 0.0000 210296.59 309155.90 31.98 2487.72 2487.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.32 56.53% 4832.18 4366 5064 4832.24 4696 4956 112676 165644 31.98
crit 10.10 24.49% 9664.71 8731 10128 9664.90 8993 10099 97621 143512 31.98
miss 7.83 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 10989 1.1% 14.7 29.13sec 69803 0 Direct 14.7 56167 112402 69803 24.2% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 1023734.05 1504986.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.11 75.75% 56166.81 52049 59193 56160.65 53070 58683 623994 917330 31.98
crit 3.56 24.25% 112402.38 104099 118387 110063.63 0 118387 399740 587656 31.32
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Crackling Jade Lightning 25 0.0% 0.2 197.83sec 15171 0 Periodic 0.6 3055 6120 3793 24.1% 0.0% 0.1%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.00 0.62 0.62 0.0000 0.8595 2347.24 2347.24 0.00 4420.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.5 75.92% 3055.48 2899 5685 463.95 0 5685 1435 1435 0.00
crit 0.1 24.08% 6119.75 5798 11369 624.81 0 11369 912 912 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 29829 2.9% 6.2 76.48sec 448591 141950 Periodic 30.8 72430 144885 90199 24.5% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 30.82 30.82 3.1603 0.6354 2780238.36 4087213.74 31.98 141950.29 141950.29
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.3 75.48% 72429.98 68020 77356 72428.95 69887 75555 1685049 2477182 31.98
crit 7.6 24.52% 144884.68 136039 154711 144871.63 0 154711 1095189 1610031 31.97
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 14567 1.4% 8.4 53.02sec 160358 0 Direct 8.4 128735 257454 160356 24.6% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 0.0000 0.0000 1354857.21 1991768.43 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 75.43% 128734.78 117900 134082 128757.77 121367 134082 820460 1206154 31.98
crit 2.08 24.57% 257453.95 235800 268164 232593.26 0 268164 534397 785615 28.89
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 15349 1.5% 0.0 0.00sec 0 0 Direct 6.1 189277 378394 235287 24.3% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.08 0.00 0.00 0.0000 0.0000 1430124.01 2102417.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.60 75.68% 189277.44 173820 197678 189176.31 0 197678 870723 1280046 31.96
crit 1.48 24.32% 378394.45 347640 395355 308773.50 0 395355 559401 822372 26.10
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7763 0.8% 0.0 0.00sec 0 0 Direct 6.1 95683 191337 119012 24.4% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.08 0.00 0.00 0.0000 0.0000 723392.56 1063455.58 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.60 75.62% 95682.60 88614 98839 95627.78 0 98839 439800 646548 31.96
crit 1.48 24.38% 191337.06 177228 197678 155953.92 0 197678 283593 416908 26.07
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 3936 0.4% 22.9 18.60sec 16038 0 Direct 22.9 12883 25773 16038 24.5% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.85 22.85 0.00 0.00 0.0000 0.0000 366530.78 538834.97 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.26 75.53% 12883.23 11830 13454 12883.31 12526 13241 222375 326912 31.98
crit 5.59 24.47% 25773.45 23660 26907 25717.24 0 26907 144156 211923 31.91
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 12266 1.2% 5.9 78.71sec 193639 327460 Periodic 17.6 52183 104362 64966 24.5% 0.0% 0.8%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 0.00 17.60 17.60 0.5914 0.1984 1143162.91 1680557.76 31.98 327460.02 327460.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.3 75.50% 52182.55 47671 53172 52186.55 50814 53172 693318 1019243 31.98
crit 4.3 24.50% 104361.73 95342 106343 103321.02 0 106343 449845 661314 31.65
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - earth_spirit 101563 / 21100
auto_attack_mh 4504 0.4% 41.3 10.17sec 10162 4959 Direct 41.3 9666 19329 10162 24.3% 19.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.25 41.25 0.00 0.00 2.0492 0.0000 419217.46 616289.38 31.98 4959.16 4959.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.31 56.51% 9665.51 8731 10128 9665.79 9299 9929 225315 331235 31.98
crit 10.03 24.32% 19329.13 17462 20256 19329.65 18161 20256 193902 285055 31.98
miss 7.91 19.17% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2261 0.2% 41.3 10.17sec 5103 2490 Direct 41.3 4832 9666 5103 24.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.25 41.25 0.00 0.00 2.0492 0.0000 210499.23 309453.81 31.98 2490.11 2490.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.28 56.44% 4832.45 4366 5064 4832.56 4702 4955 112521 165416 31.98
crit 10.14 24.57% 9666.10 8731 10128 9666.50 9124 10128 97979 144038 31.98
miss 7.83 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 11001 1.1% 14.7 29.13sec 69879 0 Direct 14.7 56175 112350 69876 24.4% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 1024840.88 1506613.17 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.09 75.61% 56175.26 52049 59193 56170.22 53799 59048 622887 915703 31.98
crit 3.58 24.39% 112349.62 104099 118387 110018.70 0 118387 401954 590910 31.31
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Crackling Jade Lightning 25 0.0% 0.2 197.83sec 15226 0 Periodic 0.6 3056 6114 3807 24.6% 0.0% 0.1%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.00 0.62 0.62 0.0000 0.8595 2355.67 2355.67 0.00 4436.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.5 75.45% 3056.40 2899 5685 464.91 0 5685 1427 1427 0.00
crit 0.2 24.55% 6113.91 5798 11369 628.03 0 11369 929 929 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 29824 2.9% 6.2 76.48sec 448426 141898 Periodic 30.8 72434 144857 90165 24.5% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 30.82 30.82 3.1603 0.6354 2779220.63 4085717.58 31.98 141898.33 141898.33
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.3 75.52% 72434.45 68020 77356 72436.01 69875 75355 1686067 2478679 31.98
crit 7.5 24.48% 144857.12 136039 154711 144797.47 0 154711 1093153 1607039 31.96
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 14570 1.4% 8.4 53.02sec 160374 0 Direct 8.4 128744 257400 160386 24.6% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 0.0000 0.0000 1354994.77 1991970.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 75.41% 128743.53 117900 134082 128747.66 0 134082 820322 1205951 31.97
crit 2.08 24.59% 257400.27 235800 268164 231854.16 0 268164 534673 786019 28.80
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 15390 1.5% 0.0 0.00sec 0 0 Direct 6.1 189280 378380 235967 24.7% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.08 0.00 0.00 0.0000 0.0000 1434422.90 2108737.53 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.58 75.30% 189280.13 173820 197678 189197.47 0 197678 866424 1273726 31.97
crit 1.50 24.70% 378380.34 347640 395355 308189.96 0 395355 567999 835012 26.05
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7771 0.8% 0.0 0.00sec 0 0 Direct 6.1 95670 191413 119163 24.5% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.08 0.00 0.00 0.0000 0.0000 724308.95 1064802.77 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.59 75.47% 95670.28 88614 98839 95638.93 0 98839 438884 645200 31.97
crit 1.49 24.53% 191412.98 177228 197678 156282.42 0 197678 285425 419602 26.12
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 3934 0.4% 22.9 18.60sec 16027 0 Direct 22.9 12886 25759 16027 24.4% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.85 22.85 0.00 0.00 0.0000 0.0000 366276.18 538460.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 75.60% 12885.56 11830 13454 12885.80 12497 13288 222629 327286 31.98
crit 5.58 24.40% 25759.02 23660 26907 25704.54 0 26907 143647 211174 31.91
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 12283 1.2% 5.9 78.71sec 193883 327873 Periodic 17.6 52183 104362 65044 24.7% 0.0% 0.8%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 0.00 17.60 17.60 0.5914 0.1984 1144603.91 1682676.17 31.98 327872.79 327872.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.3 75.35% 52182.50 47671 53172 52186.01 50238 53172 691877 1017125 31.98
crit 4.3 24.65% 104362.03 97176 106343 103393.20 0 106343 452727 665551 31.68
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
Simple Action Stats Execute Interval
Malikoom
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Malikoom
  • harmful:false
  • if_expr:
 
Energizing Elixir 7.8 61.54sec

Stats details: energizing_elixir

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: energizing_elixir

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:115288
  • name:Energizing Elixir
  • school:physical
  • tooltip:
  • description:Chug an Energizing Elixir, refilling all your Energy and Chi.
 
Eye of the Tiger (_heal) 0 0.0% 114.7 3.90sec

Stats details: eye_of_the_tiger_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 114.67 0.00 222.41 0.00 0.0000 1.9962 0.00 0.00 0.00 0.00 0.00
 
 

Action details: eye_of_the_tiger_heal

Static Values
  • id:196608
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Malikoom
  • harmful:false
  • if_expr:
Spelldata
  • id:196608
  • name:Eye of the Tiger
  • school:nature
  • tooltip:$?$w1>0[Healing $w1 every $t1 sec.][Suffering $w2 Nature damage every $t2 sec.]
  • description:{$@spelldesc196607=Tiger Palm also applies Eye of the Tiger, dealing $196608o2 Nature damage to the enemy and $196608o1 healing to the Monk over {$196608d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.430000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Malikoom
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Storm, Earth, and Fire 7.3 63.58sec

Stats details: storm_earth_and_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: storm_earth_and_fire

Static Values
  • id:137639
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:137639
  • name:Storm, Earth, and Fire
  • school:nature
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 7.23% 0.0(0.0) 1.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blackout Kick! (bok_proc) 9.1 0.0 44.1sec 44.1sec 4.23% 1.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_bok_proc
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00

Stack Uptimes

  • bok_proc_1:4.23%

Trigger Attempt Success

  • trigger_pct:7.98%

Spelldata details

  • id:116768
  • name:Blackout Kick!
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:{$@spelldesc137384=You have a $m1% chance when you Tiger Palm to cause your next Blackout Kick to cost no Chi within {$116768d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Hit Combo 1.0 303.0 0.0sec 1.5sec 100.00% 99.89% 296.0(296.0) 0.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • hit_combo_1:0.23%
  • hit_combo_2:0.34%
  • hit_combo_3:0.65%
  • hit_combo_4:0.23%
  • hit_combo_5:0.23%
  • hit_combo_6:0.39%
  • hit_combo_7:0.23%
  • hit_combo_8:97.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 117.1sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Storm, Earth, and Fire 6.3 6.3 75.5sec 34.5sec 20.77% 25.07% 0.0(0.0) 6.1

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_storm_earth_and_fire
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_earth_and_fire_2:20.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137639
  • name:Storm, Earth, and Fire
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
  • max_stacks:2
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
(sef_) earth_spirit: Hit Combo 6.3 64.1 75.6sec 6.0sec 98.92% 95.69% 20.5(20.5) 0.0

Buff details

  • buff initial source:Malikoom_earth_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:9.37%
  • sef_hit_combo_2:9.68%
  • sef_hit_combo_3:14.30%
  • sef_hit_combo_4:8.72%
  • sef_hit_combo_5:9.38%
  • sef_hit_combo_6:9.60%
  • sef_hit_combo_7:8.45%
  • sef_hit_combo_8:29.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
(sef_) fire_spirit: Hit Combo 6.3 64.1 75.6sec 6.0sec 98.92% 95.69% 20.5(20.5) 0.0

Buff details

  • buff initial source:Malikoom_fire_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:9.37%
  • sef_hit_combo_2:9.68%
  • sef_hit_combo_3:14.30%
  • sef_hit_combo_4:8.72%
  • sef_hit_combo_5:9.38%
  • sef_hit_combo_6:9.60%
  • sef_hit_combo_7:8.45%
  • sef_hit_combo_8:29.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Malikoom
blackout_kick Chi 86.5 77.4 0.9 0.9 150800.2
fists_of_fury Chi 21.5 64.6 3.0 3.0 273139.6
rising_sun_kick Chi 43.5 87.1 2.0 2.0 150640.7
strike_of_the_windlord Chi 11.4 22.8 2.0 2.0 357788.6
tiger_palm Energy 114.7 5733.7 50.0 50.0 1030.4
Resource Gains Type Count Total Average Overflow
tiger_palm Chi 114.67 219.86 (83.70%) 1.92 9.49 4.14%
energy_regen Energy 1390.65 5057.95 (89.62%) 3.64 315.28 5.87%
mp5_regen Mana 1390.65 0.00 (0.00%) 0.00 3962143.00 100.00%
blackout_kick_proc Chi 9.11 9.11 (3.47%) 1.00 0.00 0.00%
energizing_elixir_energy Energy 7.82 585.86 (10.38%) 74.90 978.58 62.55%
energizing_elixir_chi Chi 7.82 33.72 (12.84%) 4.31 44.50 56.89%
pet - fire_spirit
tiger_palm Chi 22.85 0.00 (0.00%) 0.00 22.85 100.00%
pet - earth_spirit
tiger_palm Chi 22.85 0.00 (0.00%) 0.00 22.85 100.00%
Resource RPS-Gain RPS-Loss
Energy 12.53 12.73
Chi 0.56 0.56
Combat End Resource Mean Min Max
Energy 39.95 0.00 130.00
Chi 1.81 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 5.5%

Procs

Count Interval
bok_proc 9.1 44.1sec

Statistics & Data Analysis

Fight Length
Sample Data Malikoom Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Malikoom Damage Per Second
Count 9999
Mean 212761.08
Minimum 196577.14
Maximum 232309.09
Spread ( max - min ) 35731.94
Range [ ( max - min ) / 2 * 100% ] 8.40%
Standard Deviation 4477.0551
5th Percentile 205785.80
95th Percentile 220596.66
( 95th Percentile - 5th Percentile ) 14810.86
Mean Distribution
Standard Deviation 44.7728
95.00% Confidence Intervall ( 212673.33 - 212848.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1700
0.1 Scale Factor Error with Delta=300 171107
0.05 Scale Factor Error with Delta=300 684429
0.01 Scale Factor Error with Delta=300 17110730
Priority Target DPS
Sample Data Malikoom Priority Target Damage Per Second
Count 9999
Mean 212761.08
Minimum 196577.14
Maximum 232309.09
Spread ( max - min ) 35731.94
Range [ ( max - min ) / 2 * 100% ] 8.40%
Standard Deviation 4477.0551
5th Percentile 205785.80
95th Percentile 220596.66
( 95th Percentile - 5th Percentile ) 14810.86
Mean Distribution
Standard Deviation 44.7728
95.00% Confidence Intervall ( 212673.33 - 212848.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1700
0.1 Scale Factor Error with Delta=300 171107
0.05 Scale Factor Error with Delta=300 684429
0.01 Scale Factor Error with Delta=300 17110730
DPS(e)
Sample Data Malikoom Damage Per Second (Effective)
Count 9999
Mean 212761.08
Minimum 196577.14
Maximum 232309.09
Spread ( max - min ) 35731.94
Range [ ( max - min ) / 2 * 100% ] 8.40%
Damage
Sample Data Malikoom Damage
Count 9999
Mean 76833081.83
Minimum 57461550.38
Maximum 99142774.45
Spread ( max - min ) 41681224.07
Range [ ( max - min ) / 2 * 100% ] 27.12%
DTPS
Sample Data Malikoom Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Malikoom Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Malikoom Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Malikoom Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Malikoom Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Malikoom Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MalikoomTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Malikoom Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Total Stagger damage generated
Sample Data Total Stagger damage generated
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was not purified
Sample Data Stagger damage that was not purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was purified
Sample Data Stagger damage that was purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at light stagger
Sample Data Amount of damage purified while at light stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at moderate stagger
Sample Data Amount of damage purified while at moderate stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at heavy stagger
Sample Data Amount of damage purified while at heavy stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 potion,name=old_war,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
7 0.00 call_action_list,name=serenity,if=talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.rising_sun_kick.remains<=4)|buff.serenity.up)
8 0.00 call_action_list,name=sef,if=!talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.fists_of_fury.remains<=6&cooldown.rising_sun_kick.remains<=6)|buff.storm_earth_and_fire.up)
9 0.00 call_action_list,name=serenity,if=(!artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=15&cooldown.rising_sun_kick.remains<7)|buff.serenity.up
A 0.00 call_action_list,name=sef,if=!talent.serenity.enabled&((!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5)|buff.storm_earth_and_fire.up)
B 0.00 call_action_list,name=st
actions.cd
# count action,conditions
0.00 invoke_xuen
0.00 blood_fury
0.00 berserking
0.00 touch_of_death,cycle_targets=1,max_cycle_targets=2,if=!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
C 4.31 touch_of_death,if=!artifact.gale_burst.enabled&!equipped.137057
0.00 touch_of_death,cycle_targets=1,max_cycle_targets=2,if=artifact.gale_burst.enabled&equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7&!prev_gcd.touch_of_death
0.00 touch_of_death,if=artifact.gale_burst.enabled&!equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7
actions.sef
# count action,conditions
D 3.09 energizing_elixir
0.00 arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
E 0.00 call_action_list,name=cd
F 7.30 storm_earth_and_fire
G 0.00 call_action_list,name=st
actions.st
# count action,conditions
I 0.00 call_action_list,name=cd
0.00 arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
J 4.73 energizing_elixir,if=energy<energy.max&chi<=1
K 11.38 strike_of_the_windlord,if=talent.serenity.enabled|active_enemies<6
L 21.53 fists_of_fury
M 43.53 rising_sun_kick,cycle_targets=1
N 21.22 whirling_dragon_punch
0.00 spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
0.00 rushing_jade_wind,if=chi.max-chi>1&!prev_gcd.rushing_jade_wind
O 86.53 blackout_kick,cycle_targets=1,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick
0.00 chi_wave,if=energy.time_to_max>=2.25
0.00 chi_burst,if=energy.time_to_max>=2.25
P 114.67 tiger_palm,cycle_targets=1,if=!prev_gcd.tiger_palm
0.00 crackling_jade_lightning,interrupt=1,if=talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
Q 0.80 crackling_jade_lightning,interrupt=1,if=!talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1

Sample Sequence

0245DCFKFLPMNPOPOMPOPOLPMNPOPOFMPOPOPLPMNPKPOMPOPLOPMJNOPOPOPMOPOPLMPONPKPMPOPLPMNPOPOMOPF6OPLDCMNKPOPOPMOPOPOLPMNPOPOMPOPLPMNPKOPOMPOPLJMONOPOPOMOPFOPOPOLPMNPKPOMPOPLPMNPOPOMPOCOPLJMNKPOPOPMOPOPOLPMNPOPOMPOFPOLPKPMNOPOPMPLJOMOPONOPOMPOPOPOLPKPMNPOPOMPOPLPMNPOCOPOMPFODPOKMPOPLNPMPOPOPOMPOPLMNPOPOPMKPOPLPMNPOJPOPOMOPOPOPLMPNOPO

Sample Sequence Table

time name target resources buffs
Pre flask Malikoom 130.0/130: 100% energy | 5.0/5: 100% chi
Pre augmentation Malikoom 130.0/130: 100% energy | 5.0/5: 100% chi
Pre potion Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi potion_of_the_old_war
0:00.000 energizing_elixir Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi potion_of_the_old_war
0:00.000 touch_of_death Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi potion_of_the_old_war
0:01.003 storm_earth_and_fire Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi bloodlust, hit_combo, potion_of_the_old_war
0:01.003 strike_of_the_windlord Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi bloodlust, hit_combo, storm_earth_and_fire(2), potion_of_the_old_war
0:02.509 storm_earth_and_fire Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), potion_of_the_old_war
0:02.509 fists_of_fury Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), potion_of_the_old_war
0:05.350 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(3), storm_earth_and_fire(2), potion_of_the_old_war
0:06.354 rising_sun_kick Fluffy_Pillow 95.2/130: 73% energy | 2.0/5: 40% chi bloodlust, hit_combo(4), storm_earth_and_fire(2), potion_of_the_old_war
0:07.361 whirling_dragon_punch Fluffy_Pillow 110.4/130: 85% energy | 0.0/5: 0% chi bloodlust, hit_combo(5), storm_earth_and_fire(2), potion_of_the_old_war
0:09.146 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(6), storm_earth_and_fire(2), potion_of_the_old_war
0:10.151 blackout_kick Fluffy_Pillow 95.2/130: 73% energy | 2.0/5: 40% chi bloodlust, hit_combo(7), storm_earth_and_fire(2), potion_of_the_old_war
0:11.155 tiger_palm Fluffy_Pillow 110.3/130: 85% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:12.159 blackout_kick Fluffy_Pillow 75.5/130: 58% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:13.164 rising_sun_kick Fluffy_Pillow 90.7/130: 70% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:14.167 tiger_palm Fluffy_Pillow 105.8/130: 81% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:15.170 blackout_kick Fluffy_Pillow 71.0/130: 55% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:16.174 tiger_palm Fluffy_Pillow 86.2/130: 66% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:17.179 blackout_kick Fluffy_Pillow 51.3/130: 39% energy | 3.0/5: 60% chi bloodlust, bok_proc, hit_combo(8), potion_of_the_old_war
0:18.184 fists_of_fury Fluffy_Pillow 66.5/130: 51% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:21.321 tiger_palm Fluffy_Pillow 113.9/130: 88% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:22.326 rising_sun_kick Fluffy_Pillow 79.1/130: 61% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:23.330 whirling_dragon_punch Fluffy_Pillow 94.3/130: 73% energy | 0.0/5: 0% chi bloodlust, hit_combo(8)
0:25.044 tiger_palm Fluffy_Pillow 120.2/130: 92% energy | 0.0/5: 0% chi bloodlust, hit_combo(8)
0:26.049 blackout_kick Fluffy_Pillow 85.3/130: 66% energy | 2.0/5: 40% chi bloodlust, hit_combo(8)
0:27.054 tiger_palm Fluffy_Pillow 100.5/130: 77% energy | 1.0/5: 20% chi bloodlust, hit_combo(8)
0:28.057 blackout_kick Fluffy_Pillow 65.7/130: 51% energy | 3.0/5: 60% chi bloodlust, hit_combo(8)
0:29.061 storm_earth_and_fire Fluffy_Pillow 80.8/130: 62% energy | 2.0/5: 40% chi bloodlust, hit_combo(8)
0:29.061 rising_sun_kick Fluffy_Pillow 80.8/130: 62% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:30.065 tiger_palm Fluffy_Pillow 96.0/130: 74% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:31.071 blackout_kick Fluffy_Pillow 61.2/130: 47% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:32.075 tiger_palm Fluffy_Pillow 76.4/130: 59% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:33.078 blackout_kick Fluffy_Pillow 41.5/130: 32% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:34.082 tiger_palm Fluffy_Pillow 56.7/130: 44% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:35.087 fists_of_fury Fluffy_Pillow 21.9/130: 17% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:37.917 tiger_palm Fluffy_Pillow 64.6/130: 50% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:38.921 rising_sun_kick Fluffy_Pillow 29.8/130: 23% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:39.924 whirling_dragon_punch Fluffy_Pillow 44.9/130: 35% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:41.734 tiger_palm Fluffy_Pillow 68.3/130: 53% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
0:42.738 strike_of_the_windlord Fluffy_Pillow 29.9/130: 23% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
0:44.241 Waiting 0.300 sec 47.4/130: 36% energy | 1.0/5: 20% chi hit_combo(8)
0:44.541 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
0:45.546 blackout_kick Fluffy_Pillow 12.6/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
0:46.552 Waiting 0.100 sec 24.3/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
0:46.652 rising_sun_kick Fluffy_Pillow 25.4/130: 20% energy | 2.0/5: 40% chi hit_combo(8)
0:47.907 Waiting 0.900 sec 40.0/130: 31% energy | 0.0/5: 0% chi hit_combo(8)
0:48.807 tiger_palm Fluffy_Pillow 50.5/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
0:49.811 blackout_kick Fluffy_Pillow 12.1/130: 9% energy | 2.0/5: 40% chi hit_combo(8)
0:50.815 Waiting 2.300 sec 23.8/130: 18% energy | 1.0/5: 20% chi hit_combo(8)
0:53.115 tiger_palm Fluffy_Pillow 50.5/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
0:54.120 fists_of_fury Fluffy_Pillow 12.2/130: 9% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
0:57.709 blackout_kick Fluffy_Pillow 53.9/130: 41% energy | 0.0/5: 0% chi bok_proc, hit_combo(8)
0:58.714 tiger_palm Fluffy_Pillow 65.6/130: 50% energy | 0.0/5: 0% chi hit_combo(8)
0:59.717 rising_sun_kick Fluffy_Pillow 27.2/130: 21% energy | 2.0/5: 40% chi hit_combo(8)
1:00.721 energizing_elixir Fluffy_Pillow 38.9/130: 30% energy | 0.0/5: 0% chi hit_combo(8)
1:00.721 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
1:02.500 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
1:03.504 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8)
1:04.509 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 5.0/5: 100% chi hit_combo(8)
1:05.514 tiger_palm Fluffy_Pillow 103.4/130: 80% energy | 4.0/5: 80% chi hit_combo(8)
1:06.520 blackout_kick Fluffy_Pillow 65.0/130: 50% energy | 5.0/5: 100% chi bok_proc, hit_combo(8)
1:07.525 tiger_palm Fluffy_Pillow 76.7/130: 59% energy | 5.0/5: 100% chi hit_combo(8)
1:08.530 rising_sun_kick Fluffy_Pillow 38.4/130: 30% energy | 5.0/5: 100% chi hit_combo(8)
1:09.534 blackout_kick Fluffy_Pillow 50.1/130: 39% energy | 3.0/5: 60% chi hit_combo(8)
1:10.538 tiger_palm Fluffy_Pillow 61.7/130: 47% energy | 2.0/5: 40% chi hit_combo(8)
1:11.543 blackout_kick Fluffy_Pillow 23.4/130: 18% energy | 4.0/5: 80% chi hit_combo(8)
1:12.547 Waiting 1.300 sec 35.1/130: 27% energy | 3.0/5: 60% chi hit_combo(8)
1:13.847 tiger_palm Fluffy_Pillow 50.2/130: 39% energy | 3.0/5: 60% chi hit_combo(8)
1:14.851 fists_of_fury Fluffy_Pillow 11.9/130: 9% energy | 5.0/5: 100% chi hit_combo(8)
1:18.484 rising_sun_kick Fluffy_Pillow 54.1/130: 42% energy | 2.0/5: 40% chi hit_combo(8)
1:19.489 tiger_palm Fluffy_Pillow 65.8/130: 51% energy | 0.0/5: 0% chi hit_combo(8)
1:20.494 blackout_kick Fluffy_Pillow 27.4/130: 21% energy | 2.0/5: 40% chi hit_combo(8)
1:21.496 whirling_dragon_punch Fluffy_Pillow 39.1/130: 30% energy | 1.0/5: 20% chi hit_combo(8)
1:23.175 tiger_palm Fluffy_Pillow 58.6/130: 45% energy | 1.0/5: 20% chi hit_combo(8)
1:24.178 strike_of_the_windlord Fluffy_Pillow 20.2/130: 16% energy | 3.0/5: 60% chi hit_combo(8)
1:25.682 Waiting 1.100 sec 37.7/130: 29% energy | 1.0/5: 20% chi hit_combo(8)
1:26.782 tiger_palm Fluffy_Pillow 50.5/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
1:27.787 rising_sun_kick Fluffy_Pillow 12.2/130: 9% energy | 3.0/5: 60% chi hit_combo(8)
1:28.790 Waiting 2.300 sec 23.8/130: 18% energy | 1.0/5: 20% chi hit_combo(8)
1:31.090 tiger_palm Fluffy_Pillow 50.6/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
1:32.095 blackout_kick Fluffy_Pillow 12.2/130: 9% energy | 3.0/5: 60% chi hit_combo(8)
1:33.099 Waiting 2.300 sec 23.9/130: 18% energy | 2.0/5: 40% chi hit_combo(8)
1:35.399 tiger_palm Fluffy_Pillow 50.6/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
1:36.404 fists_of_fury Fluffy_Pillow 12.3/130: 9% energy | 4.0/5: 80% chi hit_combo(8)
1:39.995 tiger_palm Fluffy_Pillow 54.0/130: 42% energy | 1.0/5: 20% chi hit_combo(8)
1:41.000 rising_sun_kick Fluffy_Pillow 15.7/130: 12% energy | 3.0/5: 60% chi hit_combo(8)
1:42.003 whirling_dragon_punch Fluffy_Pillow 27.4/130: 21% energy | 1.0/5: 20% chi hit_combo(8)
1:43.815 Waiting 0.200 sec 48.4/130: 37% energy | 1.0/5: 20% chi hit_combo(8)
1:44.015 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
1:45.021 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
1:46.026 Waiting 2.300 sec 24.1/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
1:48.326 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
1:49.329 blackout_kick Fluffy_Pillow 12.5/130: 10% energy | 4.0/5: 80% chi bok_proc, hit_combo(8)
1:50.335 rising_sun_kick Fluffy_Pillow 24.2/130: 19% energy | 4.0/5: 80% chi hit_combo(8)
1:51.338 blackout_kick Fluffy_Pillow 35.8/130: 28% energy | 2.0/5: 40% chi hit_combo(8)
1:52.344 Waiting 0.300 sec 47.5/130: 37% energy | 1.0/5: 20% chi hit_combo(8)
1:52.644 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
1:53.648 storm_earth_and_fire Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
1:53.648 potion Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
1:53.648 blackout_kick Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:54.652 Waiting 2.300 sec 24.4/130: 19% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:56.952 tiger_palm Fluffy_Pillow 51.1/130: 39% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:57.957 fists_of_fury Fluffy_Pillow 12.8/130: 10% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:01.642 energizing_elixir Fluffy_Pillow 55.6/130: 43% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:01.642 touch_of_death Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:02.648 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:03.652 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:05.368 strike_of_the_windlord Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:06.874 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:07.879 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 3.0/5: 60% chi bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:08.885 tiger_palm Fluffy_Pillow 103.4/130: 80% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:09.889 blackout_kick Fluffy_Pillow 65.0/130: 50% energy | 5.0/5: 100% chi bok_proc, hit_combo(8), potion_of_the_old_war
2:10.895 tiger_palm Fluffy_Pillow 76.7/130: 59% energy | 5.0/5: 100% chi hit_combo(8), potion_of_the_old_war
2:11.899 rising_sun_kick Fluffy_Pillow 38.4/130: 30% energy | 5.0/5: 100% chi hit_combo(8), potion_of_the_old_war
2:12.903 blackout_kick Fluffy_Pillow 50.1/130: 39% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:13.907 tiger_palm Fluffy_Pillow 61.7/130: 47% energy | 2.0/5: 40% chi hit_combo(8), potion_of_the_old_war
2:14.911 blackout_kick Fluffy_Pillow 23.4/130: 18% energy | 4.0/5: 80% chi hit_combo(8), potion_of_the_old_war
2:15.916 Waiting 1.300 sec 35.1/130: 27% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:17.216 tiger_palm Fluffy_Pillow 50.2/130: 39% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:18.221 blackout_kick Fluffy_Pillow 11.9/130: 9% energy | 5.0/5: 100% chi hit_combo(8), potion_of_the_old_war
2:19.225 fists_of_fury Fluffy_Pillow 23.5/130: 18% energy | 4.0/5: 80% chi hit_combo(8)
2:22.980 tiger_palm Fluffy_Pillow 67.2/130: 52% energy | 1.0/5: 20% chi hit_combo(8)
2:23.986 rising_sun_kick Fluffy_Pillow 28.8/130: 22% energy | 3.0/5: 60% chi hit_combo(8)
2:24.990 whirling_dragon_punch Fluffy_Pillow 40.5/130: 31% energy | 1.0/5: 20% chi hit_combo(8)
2:26.684 tiger_palm Fluffy_Pillow 60.2/130: 46% energy | 1.0/5: 20% chi hit_combo(8)
2:27.688 blackout_kick Fluffy_Pillow 21.9/130: 17% energy | 3.0/5: 60% chi hit_combo(8)
2:28.694 Waiting 1.500 sec 33.6/130: 26% energy | 2.0/5: 40% chi hit_combo(8)
2:30.194 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
2:31.199 blackout_kick Fluffy_Pillow 12.7/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
2:32.204 Waiting 0.200 sec 24.3/130: 19% energy | 3.0/5: 60% chi hit_combo(8)
2:32.404 rising_sun_kick Fluffy_Pillow 26.7/130: 21% energy | 3.0/5: 60% chi hit_combo(8)
2:33.594 Waiting 0.900 sec 40.5/130: 31% energy | 1.0/5: 20% chi hit_combo(8)
2:34.494 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
2:35.498 blackout_kick Fluffy_Pillow 12.6/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
2:36.503 Waiting 2.300 sec 24.3/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
2:38.803 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
2:39.808 fists_of_fury Fluffy_Pillow 12.7/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
2:43.534 tiger_palm Fluffy_Pillow 56.0/130: 43% energy | 1.0/5: 20% chi hit_combo(8)
2:44.538 rising_sun_kick Fluffy_Pillow 17.7/130: 14% energy | 3.0/5: 60% chi hit_combo(8)
2:45.543 whirling_dragon_punch Fluffy_Pillow 29.3/130: 23% energy | 1.0/5: 20% chi hit_combo(8)
2:47.356 tiger_palm Fluffy_Pillow 50.4/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
2:48.362 strike_of_the_windlord Fluffy_Pillow 12.1/130: 9% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
2:49.866 blackout_kick Fluffy_Pillow 29.6/130: 23% energy | 1.0/5: 20% chi bok_proc, hit_combo(8)
2:50.870 Waiting 0.800 sec 41.2/130: 32% energy | 1.0/5: 20% chi hit_combo(8)
2:51.670 tiger_palm Fluffy_Pillow 50.5/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
2:52.675 blackout_kick Fluffy_Pillow 12.2/130: 9% energy | 3.0/5: 60% chi hit_combo(8)
2:53.680 rising_sun_kick Fluffy_Pillow 23.9/130: 18% energy | 2.0/5: 40% chi hit_combo(8)
2:54.685 Waiting 1.300 sec 35.6/130: 27% energy | 0.0/5: 0% chi hit_combo(8)
2:55.985 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
2:56.989 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 2.0/5: 40% chi hit_combo(8)
2:57.993 Waiting 2.300 sec 24.0/130: 18% energy | 1.0/5: 20% chi hit_combo(8)
3:00.293 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
3:01.298 fists_of_fury Fluffy_Pillow 12.4/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
3:05.015 energizing_elixir Fluffy_Pillow 55.6/130: 43% energy | 0.0/5: 0% chi hit_combo(8)
3:05.015 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
3:06.020 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8)
3:07.025 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi hit_combo(8)
3:08.817 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi hit_combo(8)
3:09.823 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8)
3:10.826 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
3:11.830 tiger_palm Fluffy_Pillow 103.3/130: 79% energy | 3.0/5: 60% chi hit_combo(8)
3:12.834 blackout_kick Fluffy_Pillow 65.0/130: 50% energy | 5.0/5: 100% chi hit_combo(8)
3:13.838 rising_sun_kick Fluffy_Pillow 76.7/130: 59% energy | 4.0/5: 80% chi hit_combo(8)
3:14.842 blackout_kick Fluffy_Pillow 88.3/130: 68% energy | 2.0/5: 40% chi hit_combo(8)
3:15.846 tiger_palm Fluffy_Pillow 100.0/130: 77% energy | 1.0/5: 20% chi hit_combo(8)
3:16.850 storm_earth_and_fire Fluffy_Pillow 61.7/130: 47% energy | 3.0/5: 60% chi hit_combo(8)
3:16.850 blackout_kick Fluffy_Pillow 61.7/130: 47% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:17.855 tiger_palm Fluffy_Pillow 73.3/130: 56% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
3:18.860 blackout_kick Fluffy_Pillow 35.0/130: 27% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
3:19.864 Waiting 0.300 sec 46.7/130: 36% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:20.164 tiger_palm Fluffy_Pillow 50.2/130: 39% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:21.168 blackout_kick Fluffy_Pillow 11.8/130: 9% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2)
3:22.173 fists_of_fury Fluffy_Pillow 23.5/130: 18% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
3:25.908 tiger_palm Fluffy_Pillow 66.9/130: 51% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:26.911 rising_sun_kick Fluffy_Pillow 28.6/130: 22% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:27.917 whirling_dragon_punch Fluffy_Pillow 40.3/130: 31% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:29.807 tiger_palm Fluffy_Pillow 62.2/130: 48% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:30.811 strike_of_the_windlord Fluffy_Pillow 23.9/130: 18% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:32.315 Waiting 0.800 sec 41.4/130: 32% energy | 1.0/5: 20% chi hit_combo(8)
3:33.115 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
3:34.120 blackout_kick Fluffy_Pillow 12.3/130: 9% energy | 3.0/5: 60% chi hit_combo(8)
3:35.126 Waiting 0.200 sec 24.0/130: 18% energy | 2.0/5: 40% chi hit_combo(8)
3:35.326 rising_sun_kick Fluffy_Pillow 26.4/130: 20% energy | 2.0/5: 40% chi hit_combo(8)
3:36.520 Waiting 0.900 sec 40.2/130: 31% energy | 0.0/5: 0% chi hit_combo(8)
3:37.420 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
3:38.426 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
3:39.431 Waiting 2.300 sec 24.1/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
3:41.731 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
3:42.736 fists_of_fury Fluffy_Pillow 12.5/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
3:46.458 tiger_palm Fluffy_Pillow 55.7/130: 43% energy | 1.0/5: 20% chi hit_combo(8)
3:47.462 rising_sun_kick Fluffy_Pillow 17.4/130: 13% energy | 3.0/5: 60% chi hit_combo(8)
3:48.468 whirling_dragon_punch Fluffy_Pillow 29.1/130: 22% energy | 1.0/5: 20% chi hit_combo(8)
3:50.331 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
3:51.334 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
3:52.337 Waiting 2.300 sec 24.0/130: 18% energy | 2.0/5: 40% chi hit_combo(8)
3:54.637 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
3:55.642 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
3:56.647 rising_sun_kick Fluffy_Pillow 24.1/130: 19% energy | 3.0/5: 60% chi hit_combo(8)
3:57.651 Waiting 1.300 sec 35.8/130: 28% energy | 1.0/5: 20% chi hit_combo(8)
3:58.951 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
3:59.956 blackout_kick Fluffy_Pillow 12.6/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
4:00.961 Waiting 0.500 sec 24.2/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
4:01.461 touch_of_death Fluffy_Pillow 30.0/130: 23% energy | 2.0/5: 40% chi hit_combo(8)
4:02.646 blackout_kick Fluffy_Pillow 43.8/130: 34% energy | 2.0/5: 40% chi hit_combo(8)
4:03.650 tiger_palm Fluffy_Pillow 55.5/130: 43% energy | 1.0/5: 20% chi hit_combo(8)
4:04.655 fists_of_fury Fluffy_Pillow 17.2/130: 13% energy | 3.0/5: 60% chi hit_combo(8)
4:08.390 energizing_elixir Fluffy_Pillow 60.6/130: 47% energy | 0.0/5: 0% chi hit_combo(8)
4:08.390 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
4:09.397 whirling_dragon_punch Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8)
4:11.189 strike_of_the_windlord Fluffy_Pillow 130.0/130: 100% energy | 3.0/5: 60% chi hit_combo(8)
4:12.694 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8)
4:13.698 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 3.0/5: 60% chi hit_combo(8)
4:14.702 tiger_palm Fluffy_Pillow 103.3/130: 79% energy | 2.0/5: 40% chi hit_combo(8)
4:15.706 blackout_kick Fluffy_Pillow 65.0/130: 50% energy | 4.0/5: 80% chi hit_combo(8)
4:16.710 tiger_palm Fluffy_Pillow 76.7/130: 59% energy | 3.0/5: 60% chi hit_combo(8)
4:17.713 rising_sun_kick Fluffy_Pillow 38.3/130: 29% energy | 5.0/5: 100% chi hit_combo(8)
4:18.718 blackout_kick Fluffy_Pillow 50.0/130: 38% energy | 3.0/5: 60% chi hit_combo(8)
4:19.723 tiger_palm Fluffy_Pillow 61.7/130: 47% energy | 2.0/5: 40% chi hit_combo(8)
4:20.727 blackout_kick Fluffy_Pillow 23.3/130: 18% energy | 4.0/5: 80% chi hit_combo(8)
4:21.731 Waiting 1.300 sec 35.0/130: 27% energy | 3.0/5: 60% chi hit_combo(8)
4:23.031 tiger_palm Fluffy_Pillow 50.1/130: 39% energy | 3.0/5: 60% chi hit_combo(8)
4:24.036 blackout_kick Fluffy_Pillow 11.8/130: 9% energy | 5.0/5: 100% chi hit_combo(8)
4:25.040 Waiting 0.100 sec 23.5/130: 18% energy | 4.0/5: 80% chi hit_combo(8)
4:25.140 fists_of_fury Fluffy_Pillow 24.6/130: 19% energy | 4.0/5: 80% chi hit_combo(8)
4:29.119 tiger_palm Fluffy_Pillow 70.9/130: 55% energy | 1.0/5: 20% chi hit_combo(8)
4:30.124 rising_sun_kick Fluffy_Pillow 32.5/130: 25% energy | 3.0/5: 60% chi hit_combo(8)
4:31.128 whirling_dragon_punch Fluffy_Pillow 44.2/130: 34% energy | 1.0/5: 20% chi hit_combo(8)
4:32.852 tiger_palm Fluffy_Pillow 64.2/130: 49% energy | 1.0/5: 20% chi hit_combo(8)
4:33.856 blackout_kick Fluffy_Pillow 25.9/130: 20% energy | 3.0/5: 60% chi hit_combo(8)
4:34.864 Waiting 1.100 sec 37.6/130: 29% energy | 2.0/5: 40% chi hit_combo(8)
4:35.964 tiger_palm Fluffy_Pillow 50.4/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
4:36.971 blackout_kick Fluffy_Pillow 12.1/130: 9% energy | 4.0/5: 80% chi hit_combo(8)
4:37.975 Waiting 0.600 sec 23.8/130: 18% energy | 3.0/5: 60% chi hit_combo(8)
4:38.575 rising_sun_kick Fluffy_Pillow 30.7/130: 24% energy | 3.0/5: 60% chi hit_combo(8)
4:39.732 Waiting 0.500 sec 44.2/130: 34% energy | 1.0/5: 20% chi hit_combo(8)
4:40.232 tiger_palm Fluffy_Pillow 50.0/130: 38% energy | 1.0/5: 20% chi hit_combo(8)
4:41.236 blackout_kick Fluffy_Pillow 11.7/130: 9% energy | 3.0/5: 60% chi hit_combo(8)
4:42.240 storm_earth_and_fire Fluffy_Pillow 23.3/130: 18% energy | 2.0/5: 40% chi hit_combo(8)
4:42.240 Waiting 2.300 sec 23.3/130: 18% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:44.540 tiger_palm Fluffy_Pillow 50.1/130: 39% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:45.544 blackout_kick Fluffy_Pillow 11.7/130: 9% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
4:46.548 fists_of_fury Fluffy_Pillow 23.4/130: 18% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
4:50.198 tiger_palm Fluffy_Pillow 65.8/130: 51% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
4:51.202 strike_of_the_windlord Fluffy_Pillow 27.5/130: 21% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:52.708 Waiting 0.500 sec 45.0/130: 35% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
4:53.208 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
4:54.212 rising_sun_kick Fluffy_Pillow 12.5/130: 10% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), storm_earth_and_fire(2)
4:55.218 whirling_dragon_punch Fluffy_Pillow 24.1/130: 19% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), storm_earth_and_fire(2)
4:57.021 blackout_kick Fluffy_Pillow 45.1/130: 35% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), storm_earth_and_fire(2)
4:58.024 tiger_palm Fluffy_Pillow 56.7/130: 44% energy | 0.0/5: 0% chi hit_combo(8)
4:59.029 blackout_kick Fluffy_Pillow 18.4/130: 14% energy | 2.0/5: 40% chi hit_combo(8)
5:00.032 Waiting 1.800 sec 30.1/130: 23% energy | 1.0/5: 20% chi hit_combo(8)
5:01.832 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
5:02.836 rising_sun_kick Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
5:03.841 Waiting 2.300 sec 24.3/130: 19% energy | 1.0/5: 20% chi hit_combo(8)
5:06.141 tiger_palm Fluffy_Pillow 51.1/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
5:07.145 fists_of_fury Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
5:10.841 energizing_elixir Fluffy_Pillow 55.7/130: 43% energy | 0.0/5: 0% chi hit_combo(8)
5:10.841 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
5:11.845 rising_sun_kick Fluffy_Pillow 130.0/130: 100% energy | 4.0/5: 80% chi hit_combo(8)
5:12.849 blackout_kick Fluffy_Pillow 130.0/130: 100% energy | 2.0/5: 40% chi hit_combo(8)
5:13.854 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8)
5:14.858 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 3.0/5: 60% chi hit_combo(8)
5:15.863 whirling_dragon_punch Fluffy_Pillow 103.3/130: 79% energy | 2.0/5: 40% chi hit_combo(8)
5:17.653 blackout_kick Fluffy_Pillow 124.1/130: 95% energy | 2.0/5: 40% chi hit_combo(8)
5:18.656 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 1.0/5: 20% chi hit_combo(8)
5:19.662 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 3.0/5: 60% chi hit_combo(8)
5:20.666 rising_sun_kick Fluffy_Pillow 103.4/130: 80% energy | 2.0/5: 40% chi hit_combo(8)
5:21.671 tiger_palm Fluffy_Pillow 115.0/130: 88% energy | 0.0/5: 0% chi hit_combo(8)
5:22.675 blackout_kick Fluffy_Pillow 76.7/130: 59% energy | 2.0/5: 40% chi hit_combo(8)
5:23.680 tiger_palm Fluffy_Pillow 88.4/130: 68% energy | 1.0/5: 20% chi hit_combo(8)
5:24.685 blackout_kick Fluffy_Pillow 50.1/130: 39% energy | 3.0/5: 60% chi hit_combo(8)
5:25.689 tiger_palm Fluffy_Pillow 61.7/130: 47% energy | 2.0/5: 40% chi hit_combo(8)
5:26.692 blackout_kick Fluffy_Pillow 23.4/130: 18% energy | 4.0/5: 80% chi hit_combo(8)
5:27.697 fists_of_fury Fluffy_Pillow 35.1/130: 27% energy | 3.0/5: 60% chi hit_combo(8)
5:31.535 tiger_palm Fluffy_Pillow 79.7/130: 61% energy | 0.0/5: 0% chi hit_combo(8)
5:32.539 strike_of_the_windlord Fluffy_Pillow 41.3/130: 32% energy | 2.0/5: 40% chi hit_combo(8)
5:34.045 tiger_palm Fluffy_Pillow 58.8/130: 45% energy | 0.0/5: 0% chi hit_combo(8)
5:35.050 rising_sun_kick Fluffy_Pillow 20.5/130: 16% energy | 2.0/5: 40% chi hit_combo(8)
5:36.053 Waiting 0.300 sec 32.2/130: 25% energy | 0.0/5: 0% chi hit_combo(8)
5:36.353 whirling_dragon_punch Fluffy_Pillow 35.6/130: 27% energy | 0.0/5: 0% chi hit_combo(8)
5:38.345 tiger_palm Fluffy_Pillow 58.8/130: 45% energy | 0.0/5: 0% chi hit_combo(8)
5:39.350 blackout_kick Fluffy_Pillow 20.5/130: 16% energy | 2.0/5: 40% chi hit_combo(8)
5:40.354 Waiting 1.600 sec 32.1/130: 25% energy | 1.0/5: 20% chi hit_combo(8)
5:41.954 tiger_palm Fluffy_Pillow 50.7/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
5:42.957 blackout_kick Fluffy_Pillow 12.4/130: 10% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
5:43.963 rising_sun_kick Fluffy_Pillow 24.1/130: 19% energy | 3.0/5: 60% chi hit_combo(8)
5:44.967 Waiting 1.300 sec 35.7/130: 27% energy | 1.0/5: 20% chi hit_combo(8)
5:46.267 tiger_palm Fluffy_Pillow 50.8/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
5:47.270 blackout_kick Fluffy_Pillow 12.5/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
5:48.274 Waiting 2.300 sec 24.2/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
5:50.574 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
5:51.579 fists_of_fury Fluffy_Pillow 12.6/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
5:55.323 tiger_palm Fluffy_Pillow 56.1/130: 43% energy | 1.0/5: 20% chi hit_combo(8)
5:56.327 rising_sun_kick Fluffy_Pillow 17.7/130: 14% energy | 3.0/5: 60% chi hit_combo(8)
5:57.330 whirling_dragon_punch Fluffy_Pillow 29.4/130: 23% energy | 1.0/5: 20% chi hit_combo(8)
5:59.093 Waiting 0.100 sec 49.9/130: 38% energy | 1.0/5: 20% chi hit_combo(8)
5:59.193 tiger_palm Fluffy_Pillow 51.1/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
6:00.198 blackout_kick Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
6:01.200 Waiting 0.200 sec 24.4/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
6:01.400 touch_of_death Fluffy_Pillow 26.7/130: 21% energy | 2.0/5: 40% chi hit_combo(8)
6:02.646 blackout_kick Fluffy_Pillow 41.2/130: 32% energy | 2.0/5: 40% chi hit_combo(8)
6:03.651 tiger_palm Fluffy_Pillow 52.9/130: 41% energy | 1.0/5: 20% chi hit_combo(8)
6:04.655 blackout_kick Fluffy_Pillow 14.5/130: 11% energy | 3.0/5: 60% chi hit_combo(8)
6:05.659 rising_sun_kick Fluffy_Pillow 26.2/130: 20% energy | 2.0/5: 40% chi hit_combo(8)
6:06.662 Waiting 1.100 sec 37.8/130: 29% energy | 0.0/5: 0% chi hit_combo(8)
6:07.762 tiger_palm Fluffy_Pillow 50.6/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
6:08.768 storm_earth_and_fire Fluffy_Pillow 12.3/130: 9% energy | 2.0/5: 40% chi hit_combo(8)
6:08.768 blackout_kick Fluffy_Pillow 12.3/130: 9% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:09.773 Waiting 0.900 sec 24.0/130: 18% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
6:10.673 energizing_elixir Fluffy_Pillow 34.5/130: 27% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
6:10.841 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2)
6:11.847 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2)
6:12.852 strike_of_the_windlord Fluffy_Pillow 103.4/130: 80% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
6:14.357 rising_sun_kick Fluffy_Pillow 120.9/130: 93% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:15.364 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:16.369 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:17.373 tiger_palm Fluffy_Pillow 103.3/130: 79% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
6:18.378 fists_of_fury Fluffy_Pillow 65.0/130: 50% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
6:22.000 whirling_dragon_punch Fluffy_Pillow 107.1/130: 82% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:23.878 tiger_palm Fluffy_Pillow 128.9/130: 99% energy | 0.0/5: 0% chi hit_combo(8)
6:24.883 rising_sun_kick Fluffy_Pillow 90.6/130: 70% energy | 2.0/5: 40% chi hit_combo(8)
6:25.888 tiger_palm Fluffy_Pillow 102.3/130: 79% energy | 0.0/5: 0% chi hit_combo(8)
6:26.891 blackout_kick Fluffy_Pillow 63.9/130: 49% energy | 2.0/5: 40% chi hit_combo(8)
6:27.896 tiger_palm Fluffy_Pillow 75.6/130: 58% energy | 1.0/5: 20% chi hit_combo(8)
6:28.902 blackout_kick Fluffy_Pillow 37.3/130: 29% energy | 3.0/5: 60% chi hit_combo(8)
6:29.906 Waiting 0.100 sec 49.0/130: 38% energy | 2.0/5: 40% chi hit_combo(8)
6:30.006 tiger_palm Fluffy_Pillow 50.1/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
6:31.012 blackout_kick Fluffy_Pillow 11.8/130: 9% energy | 4.0/5: 80% chi hit_combo(8)
6:32.015 Waiting 1.300 sec 23.5/130: 18% energy | 3.0/5: 60% chi hit_combo(8)
6:33.315 rising_sun_kick Fluffy_Pillow 38.6/130: 30% energy | 3.0/5: 60% chi hit_combo(8)
6:34.492 tiger_palm Fluffy_Pillow 52.3/130: 40% energy | 1.0/5: 20% chi hit_combo(8)
6:35.496 blackout_kick Fluffy_Pillow 13.9/130: 11% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
6:36.501 Waiting 2.100 sec 25.6/130: 20% energy | 3.0/5: 60% chi hit_combo(8)
6:38.601 tiger_palm Fluffy_Pillow 50.0/130: 38% energy | 3.0/5: 60% chi hit_combo(8)
6:39.604 fists_of_fury Fluffy_Pillow 11.7/130: 9% energy | 5.0/5: 100% chi hit_combo(8)
6:43.278 rising_sun_kick Fluffy_Pillow 54.4/130: 42% energy | 2.0/5: 40% chi hit_combo(8)
6:44.282 whirling_dragon_punch Fluffy_Pillow 66.0/130: 51% energy | 0.0/5: 0% chi hit_combo(8)
6:46.060 tiger_palm Fluffy_Pillow 86.7/130: 67% energy | 0.0/5: 0% chi hit_combo(8)
6:47.065 blackout_kick Fluffy_Pillow 48.4/130: 37% energy | 2.0/5: 40% chi hit_combo(8)
6:48.071 tiger_palm Fluffy_Pillow 60.1/130: 46% energy | 1.0/5: 20% chi hit_combo(8)
6:49.076 blackout_kick Fluffy_Pillow 21.7/130: 17% energy | 3.0/5: 60% chi hit_combo(8)
6:50.081 Waiting 1.500 sec 33.4/130: 26% energy | 2.0/5: 40% chi hit_combo(8)
6:51.581 tiger_palm Fluffy_Pillow 50.9/130: 39% energy | 2.0/5: 40% chi hit_combo(8)
6:52.585 rising_sun_kick Fluffy_Pillow 12.5/130: 10% energy | 4.0/5: 80% chi hit_combo(8)
6:53.591 strike_of_the_windlord Fluffy_Pillow 24.2/130: 19% energy | 2.0/5: 40% chi hit_combo(8)
6:55.095 Waiting 0.800 sec 41.7/130: 32% energy | 0.0/5: 0% chi hit_combo(8)
6:55.895 tiger_palm Fluffy_Pillow 51.0/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
6:56.900 blackout_kick Fluffy_Pillow 12.7/130: 10% energy | 2.0/5: 40% chi hit_combo(8)
6:57.906 Waiting 2.300 sec 24.4/130: 19% energy | 1.0/5: 20% chi hit_combo(8)
7:00.206 tiger_palm Fluffy_Pillow 51.1/130: 39% energy | 1.0/5: 20% chi hit_combo(8)
7:01.210 fists_of_fury Fluffy_Pillow 12.7/130: 10% energy | 3.0/5: 60% chi hit_combo(8)
7:04.939 tiger_palm Fluffy_Pillow 56.1/130: 43% energy | 0.0/5: 0% chi hit_combo(8)
7:05.943 rising_sun_kick Fluffy_Pillow 17.7/130: 14% energy | 2.0/5: 40% chi hit_combo(8)
7:06.948 whirling_dragon_punch Fluffy_Pillow 29.4/130: 23% energy | 0.0/5: 0% chi hit_combo(8)
7:08.649 Waiting 0.100 sec 49.2/130: 38% energy | 0.0/5: 0% chi hit_combo(8)
7:08.749 tiger_palm Fluffy_Pillow 50.4/130: 39% energy | 0.0/5: 0% chi hit_combo(8)
7:09.753 blackout_kick Fluffy_Pillow 12.0/130: 9% energy | 2.0/5: 40% chi hit_combo(8)
7:10.760 energizing_elixir Fluffy_Pillow 23.7/130: 18% energy | 1.0/5: 20% chi hit_combo(8)
7:10.841 tiger_palm Fluffy_Pillow 130.0/130: 100% energy | 5.0/5: 100% chi hit_combo(8)
7:11.846 blackout_kick Fluffy_Pillow 91.7/130: 71% energy | 5.0/5: 100% chi hit_combo(8)
7:12.850 tiger_palm Fluffy_Pillow 103.3/130: 79% energy | 4.0/5: 80% chi hit_combo(8)
7:13.856 blackout_kick Fluffy_Pillow 65.0/130: 50% energy | 5.0/5: 100% chi hit_combo(8)
7:14.859 rising_sun_kick Fluffy_Pillow 76.7/130: 59% energy | 4.0/5: 80% chi hit_combo(8)
7:15.865 blackout_kick Fluffy_Pillow 88.4/130: 68% energy | 2.0/5: 40% chi hit_combo(8)
7:16.870 tiger_palm Fluffy_Pillow 100.1/130: 77% energy | 1.0/5: 20% chi hit_combo(8)
7:17.875 blackout_kick Fluffy_Pillow 61.7/130: 47% energy | 3.0/5: 60% chi hit_combo(8)
7:18.882 tiger_palm Fluffy_Pillow 73.4/130: 56% energy | 2.0/5: 40% chi hit_combo(8)
7:19.886 blackout_kick Fluffy_Pillow 35.1/130: 27% energy | 4.0/5: 80% chi hit_combo(8)
7:20.890 Waiting 0.300 sec 46.8/130: 36% energy | 3.0/5: 60% chi hit_combo(8)
7:21.190 tiger_palm Fluffy_Pillow 50.3/130: 39% energy | 3.0/5: 60% chi hit_combo(8)
7:22.195 fists_of_fury Fluffy_Pillow 11.9/130: 9% energy | 5.0/5: 100% chi hit_combo(8)
7:25.842 rising_sun_kick Fluffy_Pillow 54.3/130: 42% energy | 2.0/5: 40% chi hit_combo(8)
7:26.846 tiger_palm Fluffy_Pillow 66.0/130: 51% energy | 0.0/5: 0% chi hit_combo(8)
7:27.852 whirling_dragon_punch Fluffy_Pillow 27.7/130: 21% energy | 2.0/5: 40% chi hit_combo(8)
7:29.629 blackout_kick Fluffy_Pillow 48.3/130: 37% energy | 2.0/5: 40% chi hit_combo(8)
7:30.635 tiger_palm Fluffy_Pillow 60.0/130: 46% energy | 1.0/5: 20% chi hit_combo(8)
7:31.640 blackout_kick Fluffy_Pillow 21.7/130: 17% energy | 3.0/5: 60% chi hit_combo(8)
7:32.645 Waiting 0.200 sec 33.4/130: 26% energy | 2.0/5: 40% chi hit_combo(8)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4727 4402 0
Agility 23223 21517 11465 (8021)
Stamina 26691 26691 16800
Intellect 7652 7327 0
Spirit 2 2 0
Health 1601460 1601460 0
Energy 130 130 0
Chi 5 5 0
Crit 24.53% 24.53% 3337
Haste 16.20% 16.20% 5266
Damage / Heal Versatility 5.43% 5.43% 2172
ManaReg per Second 8800 8800 0
Attack Power 23223 21517 0
Mastery 32.64% 32.64% 6339
Armor 1922 1922 1922
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 839.00
Local Head Swordsinger's Hood
ilevel: 830, stats: { 250 Armor, +1077 AgiInt, +1615 Sta, +709 Mastery, +502 Haste }
Local Neck Lavadrip Pendant
ilevel: 835, stats: { +952 Sta, +1042 Mastery, +695 Haste }, gems: { +150 Vers }
Local Shoulders Dreadhide Mantle
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +552 Crit, +391 Haste }
Local Chest Tranquil Bough Vest
ilevel: 835, stats: { 313 Armor, +1128 AgiInt, +1692 Sta, +829 Haste, +405 Mastery }
Local Waist Tranquil Bough Cinch
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +633 Haste, +310 Mastery }
Local Legs Grandmaster's Legguards
ilevel: 820, stats: { 261 Armor, +1471 Sta, +981 AgiInt, +834 Crit, +333 Vers }
Local Feet Brinewashed Leather Boots
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +633 Mastery, +310 Vers }
Local Wrists Tranquil Bough Wristwraps
ilevel: 835, stats: { 137 Armor, +635 AgiInt, +952 Sta, +466 Haste, +228 Mastery }
Local Hands Biornskin Gloves
ilevel: 835, stats: { 196 Armor, +846 AgiInt, +1269 Sta, +628 Crit, +297 Mastery }
Local Finger1 Woe-Bearer's Band
ilevel: 830, stats: { +908 Sta, +973 Mastery, +729 Crit }
Local Finger2 Roggstone Signet
ilevel: 845, stats: { +1045 Sta, +308 Avoidance, +1287 Haste, +514 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 845, stats: { +1177 Agi, +915 Mastery }
Local Trinket2 Three-Toed Rabbit Foot
ilevel: 830, stats: { +1023 Agi, +865 Vers }
Local Back Seacursed Wrap
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +463 Haste, +257 Mastery }
Local Main Hand Fists of the Heavens
ilevel: 862, weapon: { 3684 - 6844, 2.6 }, stats: { +622 Agi, +932 Sta, +297 Crit, +285 Mastery }, relics: { +36 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Fists of the Heavens
ilevel: 862, weapon: { 3684 - 6844, 2.6 }, stats: { +622 Agi, +932 Sta, +297 Crit, +285 Mastery }
Local Tabard Stormwind Tabard
ilevel: 600

Talents

Level
15 Chi Burst Eye of the Tiger Chi Wave
30 Chi Torpedo Tiger's Lust Celerity
45 Energizing Elixir (Windwalker Monk) Ascension (Windwalker Monk) Power Strikes (Windwalker Monk)
60 Ring of Peace Dizzying Kicks (Windwalker Monk) Leg Sweep
75 Healing Elixir Diffuse Magic Dampen Harm
90 Rushing Jade Wind Invoke Xuen, the White Tiger (Windwalker Monk) Hit Combo (Windwalker Monk)
100 Chi Orbit (Windwalker Monk) Whirling Dragon Punch (Windwalker Monk) Serenity (Windwalker Monk)

Profile

monk="Malikoom"
origin="https://eu.api.battle.net/wow/character/hyjal/Malikoom/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/85/114737493-avatar.jpg"
level=110
race=pandaren_alliance
role=dps
position=back
professions=mining=669/jewelcrafting=391
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fb!1202021
artifact=50:0:0:0:0:800:1:801:3:820:3:822:3:825:3:827:1:831:1:1341:1
spec=windwalker

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/potion,name=old_war,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
actions+=/call_action_list,name=serenity,if=talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.rising_sun_kick.remains<=4)|buff.serenity.up)
actions+=/call_action_list,name=sef,if=!talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.fists_of_fury.remains<=6&cooldown.rising_sun_kick.remains<=6)|buff.storm_earth_and_fire.up)
actions+=/call_action_list,name=serenity,if=(!artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=15&cooldown.rising_sun_kick.remains<7)|buff.serenity.up
actions+=/call_action_list,name=sef,if=!talent.serenity.enabled&((!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5)|buff.storm_earth_and_fire.up)
actions+=/call_action_list,name=st

actions.cd=invoke_xuen
actions.cd+=/blood_fury
actions.cd+=/berserking
actions.cd+=/touch_of_death,cycle_targets=1,max_cycle_targets=2,if=!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
actions.cd+=/touch_of_death,if=!artifact.gale_burst.enabled&!equipped.137057
actions.cd+=/touch_of_death,cycle_targets=1,max_cycle_targets=2,if=artifact.gale_burst.enabled&equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7&!prev_gcd.touch_of_death
actions.cd+=/touch_of_death,if=artifact.gale_burst.enabled&!equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7

actions.sef=energizing_elixir
actions.sef+=/arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
actions.sef+=/call_action_list,name=cd
actions.sef+=/storm_earth_and_fire
actions.sef+=/call_action_list,name=st

actions.serenity=energizing_elixir
actions.serenity+=/call_action_list,name=cd
actions.serenity+=/serenity
actions.serenity+=/strike_of_the_windlord
actions.serenity+=/rising_sun_kick,cycle_targets=1,if=active_enemies<3
actions.serenity+=/fists_of_fury
actions.serenity+=/spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
actions.serenity+=/rising_sun_kick,cycle_targets=1,if=active_enemies>=3
actions.serenity+=/blackout_kick,cycle_targets=1,if=!prev_gcd.blackout_kick
actions.serenity+=/spinning_crane_kick,if=!prev_gcd.spinning_crane_kick
actions.serenity+=/rushing_jade_wind,if=!prev_gcd.rushing_jade_wind

actions.st=call_action_list,name=cd
actions.st+=/arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
actions.st+=/energizing_elixir,if=energy<energy.max&chi<=1
actions.st+=/strike_of_the_windlord,if=talent.serenity.enabled|active_enemies<6
actions.st+=/fists_of_fury
actions.st+=/rising_sun_kick,cycle_targets=1
actions.st+=/whirling_dragon_punch
actions.st+=/spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
actions.st+=/rushing_jade_wind,if=chi.max-chi>1&!prev_gcd.rushing_jade_wind
actions.st+=/blackout_kick,cycle_targets=1,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick
actions.st+=/chi_wave,if=energy.time_to_max>=2.25
actions.st+=/chi_burst,if=energy.time_to_max>=2.25
actions.st+=/tiger_palm,cycle_targets=1,if=!prev_gcd.tiger_palm
actions.st+=/crackling_jade_lightning,interrupt=1,if=talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
actions.st+=/crackling_jade_lightning,interrupt=1,if=!talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1

head=swordsingers_hood,id=134284,bonus_id=3397/1492/1675
neck=lavadrip_pendant,id=137535,bonus_id=1726/1808/1487/3339,gems=150vers
shoulders=dreadhide_mantle,id=121298,bonus_id=3432/1502/3336
back=seacursed_wrap,id=133771,bonus_id=3410/1497/1813
chest=tranquil_bough_vest,id=139071,bonus_id=3432/1497/1674
tabard=stormwind_tabard,id=118365
wrists=tranquil_bough_wristwraps,id=139066,bonus_id=3432/1497/1674
hands=biornskin_gloves,id=134195,bonus_id=3397/1497/3336
waist=tranquil_bough_cinch,id=139073,bonus_id=3432/1502/3336
legs=grandmasters_legguards,id=139735,bonus_id=3385/3382
feet=brinewashed_leather_boots,id=134237,bonus_id=3397/1502/3336
finger1=woebearers_band,id=133638,bonus_id=1726/1482/3339
finger2=roggstone_signet,id=134157,bonus_id=3432/40/1507/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3396/605/1507/3337
trinket2=threetoed_rabbit_foot,id=134203,bonus_id=3396/607/1492/3339
main_hand=fists_of_the_heavens,id=128940,bonus_id=734,gem_id=137550/133763/142064/0,relic_id=1726:1477/1727:1492:1813/0/0
off_hand=fists_of_the_heavens,id=133948

# Gear Summary
# gear_ilvl=839.31
# gear_agility=11465
# gear_stamina=16800
# gear_crit_rating=3337
# gear_haste_rating=5266
# gear_mastery_rating=6339
# gear_versatility_rating=2172
# gear_avoidance_rating=308
# gear_armor=1922

Müjnir

Müjnir : 218965 dps

  • Race: Pandaren Alliance
  • Class: Monk
  • Spec: Windwalker
  • Level: 110
  • Role: Dps
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
218965.1 218965.1 89.0 / 0.041% 17855.2 / 8.2% 14736.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.2 Energy 12.31% 44.0 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Müjnir/advanced
Talents
  • 15: Chi Burst
  • 30: Tiger's Lust
  • 45: Energizing Elixir (Windwalker Monk)
  • 60: Leg Sweep
  • 75: Diffuse Magic
  • 90: Hit Combo (Windwalker Monk)
  • 100: Whirling Dragon Punch (Windwalker Monk)
  • Talent Calculator
Artifact
Professions
  • herbalism: 800
  • inscription: 737

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Müjnir 218965
Blackout Kick 28088 12.8% 87.5 5.04sec 144646 143999 Direct 87.5 112840 225534 144645 28.2% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.54 87.54 0.00 0.00 1.0045 0.0000 12663004.76 18615816.47 31.98 143999.24 143999.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.84 71.78% 112840.02 54777 123862 112774.31 103296 121242 7090424 10423595 31.98
crit 24.71 28.22% 225533.83 109554 247724 225406.99 179600 247724 5572581 8192222 31.98
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!prev_gcd.blackout_kick
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Burst (_damage) 5784 2.6% 13.6 33.00sec 191200 0 Direct 13.6 149236 297741 191194 28.3% 0.0%  

Stats details: chi_burst_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.64 13.64 0.00 0.00 0.0000 0.0000 2607022.89 2607022.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.78 71.74% 149236.13 73162 162581 149218.47 108929 162581 1459842 1459842 0.00
crit 3.85 28.26% 297741.20 146323 325163 293525.15 0 325163 1147181 1147181 0.00
 
 

Action details: chi_burst_damage

Static Values
  • id:148135
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148135
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crackling Jade Lightning 43 0.0% 1.2 116.26sec 15459 7825 Periodic 2.5 6038 12093 7746 28.2% 0.0% 0.5%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.24 0.00 2.47 2.47 1.9764 0.8645 19163.80 19163.80 0.00 7825.15 7825.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.8 71.78% 6038.29 3105 6899 4152.86 0 6899 10723 10723 0.00
crit 0.7 28.22% 12092.74 6209 13798 5484.28 0 13798 8441 8441 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 35705 (44006) 16.3% (20.1%) 21.3 21.50sec 931012 259793 Periodic 106.1 118186 236417 151656 28.3% 0.0% 15.8%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.30 0.00 106.11 106.11 3.5837 0.6688 16092049.39 23656836.88 31.98 259792.65 259792.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.1 71.69% 118186.23 57879 140754 118096.78 106752 129405 8990267 13216545 31.98
crit 30.0 28.31% 236416.59 115758 281507 236184.72 186314 276815 7101782 10440292 31.98
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:5.250000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Crosswinds 8301 3.8% 0.0 0.00sec 0 0 Periodic 169.6 17207 34389 22062 28.3% 0.0% 18.8%

Stats details: crosswinds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 169.57 169.57 0.0000 0.5000 3741040.81 5499684.35 31.98 44123.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.7 71.74% 17206.54 8418 20472 17193.86 15838 18603 2093191 3077189 31.98
crit 47.9 28.26% 34388.81 16837 40945 34365.30 29011 39620 1647850 2422496 31.98
 
 

Action details: crosswinds

Static Values
  • id:195651
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195651
  • name:Crosswinds
  • school:nature
  • tooltip:
  • description:{$@spelldesc195650=During Fists of Fury, Wind Spirit images of you attack your Fists of Fury targets for a total of ${8*{$196061s1=1}} additional Physical damage.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: crosswinds_tick

Static Values
  • id:196061
  • school:physical
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196061
  • name:Crosswinds
  • school:physical
  • tooltip:
  • description:{$@spelldesc195650=During Fists of Fury, Wind Spirit images of you attack your Fists of Fury targets for a total of ${8*{$196061s1=1}} additional Physical damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee_main_hand 6574 3.0% 159.9 2.84sec 18534 8499 Direct 159.9 16971 33945 18534 28.2% 19.0%  

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.86 159.86 0.00 0.00 2.1809 0.0000 2962833.36 4355645.69 31.98 8498.50 8498.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.40 52.80% 16970.85 7992 19076 16960.95 15425 18267 1432321 2105648 31.98
crit 45.09 28.21% 33945.01 15984 38152 33925.85 28826 37901 1530512 2249998 31.98
miss 30.37 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_off_hand 3265 1.5% 158.9 2.84sec 9266 4236 Direct 158.9 8488 16970 9265 28.2% 19.0%  

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 158.86 158.86 0.00 0.00 2.1875 0.0000 1471893.22 2163822.46 31.98 4235.62 4235.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.77 52.73% 8488.26 3996 9538 8483.32 7608 9159 711091 1045371 31.98
crit 44.83 28.22% 16970.03 7992 19076 16959.27 14083 18820 760803 1118452 31.98
miss 30.25 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Pepper Breath 3781 1.7% 20.2 21.94sec 84150 0 Periodic 100.4 16963 0 16963 0.0% 0.0% 5.6%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.24 0.00 100.74 100.39 0.0000 0.2496 1702812.87 1702812.87 0.00 67722.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.4 100.00% 16962.63 68 16990 16963.88 16604 16990 1702813 1702813 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.7500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Potion of the Old War 6200 2.8% 22.9 6.52sec 119935 0 Direct 22.9 93665 187095 119930 28.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.92 22.92 0.00 0.00 0.0000 0.0000 2748763.54 4040942.77 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.48 71.89% 93664.64 58489 142237 93654.64 67343 122863 1543143 2268567 31.98
crit 6.44 28.11% 187094.61 116977 284473 186958.10 0 284473 1205620 1772376 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rising Sun Kick 27829 12.7% 42.9 10.46sec 292230 290920 Direct 42.9 227894 455715 292228 28.2% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.93 42.93 0.00 0.00 1.0045 0.0000 12544491.54 18441590.81 31.98 290920.49 290920.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.80 71.76% 227894.06 109314 256170 227729.40 200778 256170 7020102 10320215 31.98
crit 12.12 28.24% 455715.49 218628 512339 455387.68 230553 512339 5524390 8121376 31.98
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 11861 (17795) 5.4% (8.1%) 11.3 41.64sec 710387 472184 Direct 11.3 369473 738601 473442 28.2% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 1.5045 0.0000 5348074.57 7862176.20 31.98 472184.03 472184.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.11 71.83% 369472.73 212873 527634 368867.67 229248 527634 2998067 4407442 31.98
crit 3.18 28.17% 738600.79 425746 1055269 718365.82 0 1055269 2350008 3454734 31.14
 
 

Action details: strike_of_the_windlord

Static Values
  • id:205320
  • school:physical
  • resource:chi
  • range:9.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205320
  • name:Strike of the Windlord
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
    Strike of the Windlord (_offhand) 5934 2.7% 0.0 0.00sec 0 0 Direct 11.3 184614 369924 236953 28.2% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.30 0.00 0.00 0.0000 0.0000 2676693.01 3934992.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.11 71.75% 184613.65 106437 263817 184337.25 112577 263817 1496378 2199817 31.98
crit 3.19 28.25% 369924.41 212873 527634 360071.00 0 527634 1180315 1735175 31.11
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 8607 3.9% 109.9 4.07sec 35309 35151 Direct 109.9 27554 55142 35308 28.1% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.88 109.88 0.00 0.00 1.0045 0.0000 3879790.26 5703659.19 31.98 35150.67 35150.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.99 71.89% 27553.70 12974 30967 27538.14 25553 29239 2176606 3199818 31.98
crit 30.89 28.11% 55141.51 25948 61934 55110.08 45798 61934 1703184 2503842 31.98
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!prev_gcd.tiger_palm
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Touch of Death 10761 4.9% 4.3 120.54sec 1122565 1117777 Periodic 4.2 1146446 0 1146446 0.0% 0.0% 7.5%

Stats details: touch_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 4.22 4.22 1.0045 8.0000 4839975.34 0.00 0.00 127020.14 1117777.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.2 100.00% 1146445.73 1146446 1146446 1146445.72 1146446 1146446 4839975 0 0.00
 
 

Action details: touch_of_death

Static Values
  • id:115080
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
Spelldata
  • id:115080
  • name:Touch of Death
  • school:physical
  • tooltip:Taking $w1 damage when this effect expires.
  • description:Use ancient Pandaren knowledge of anatomy to inflict mortal damage on an enemy. After {$d=8 seconds}, the target will take damage equal to your maximum health, reduced against players.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:8.00
  • base_tick_time:8.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Whirling Dragon Punch 17003 7.8% 21.0 21.62sec 365571 208986 Periodic 62.8 95007 190443 121993 28.3% 0.0% 2.9%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.96 0.00 62.82 62.82 1.7493 0.2102 7663711.30 11266381.53 31.98 208985.61 208985.61
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.1 71.72% 95007.29 48341 111262 94951.00 81435 109513 4280768 6293135 31.98
crit 17.8 28.28% 190443.04 96682 222523 190297.53 114571 222523 3382943 4973247 31.98
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - fire_spirit 93801 / 19622
auto_attack_mh 4230 0.4% 41.5 10.13sec 9554 4623 Direct 41.5 8764 17532 9554 28.1% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.50 41.50 0.00 0.00 2.0667 0.0000 396543.08 582955.89 31.98 4623.01 4623.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.91 52.80% 8764.06 7923 9191 8764.43 8477 9022 192060 282346 31.98
crit 11.66 28.10% 17532.07 15846 18381 17532.86 16480 18318 204483 300610 31.98
miss 7.93 19.10% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2115 0.2% 41.5 10.13sec 4778 2312 Direct 41.5 4382 8766 4778 28.1% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.50 41.50 0.00 0.00 2.0667 0.0000 198319.18 291547.98 31.98 2312.06 2312.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.93 52.84% 4382.14 3961 4595 4382.28 4232 4507 96097 141272 31.98
crit 11.66 28.10% 8766.17 7923 9191 8766.76 8266 9191 102222 150276 31.98
miss 7.91 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 10265 1.0% 14.2 30.05sec 67777 0 Direct 14.2 52811 105624 67774 28.3% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 0.00 0.00 0.0000 0.0000 961681.59 1413763.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.17 71.66% 52811.34 49011 55738 52803.28 49972 55738 536987 789422 31.98
crit 4.02 28.34% 105624.44 98022 111476 104574.02 0 111476 424695 624342 31.66
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Burst (_damage) 1922 0.2% 0.0 0.00sec 0 0 Direct 2.1 68890 137495 88160 28.1% 0.0%  

Stats details: chi_burst_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 2.05 0.00 0.00 0.0000 0.0000 180778.75 180778.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.47 71.92% 68889.87 64332 73162 59349.76 0 73162 101601 101601 0.00
crit 0.58 28.08% 137495.48 128663 146323 63920.19 0 146323 79178 79178 0.00
 
 

Action details: chi_burst_damage

Static Values
  • id:148135
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148135
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crackling Jade Lightning 44 0.0% 0.3 138.96sec 14640 0 Periodic 1.1 2858 5709 3670 28.5% 0.0% 0.2%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.28 0.00 1.12 1.12 0.0000 0.8627 4103.99 4103.99 0.00 4257.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.8 71.51% 2857.51 2730 5947 748.50 0 5947 2285 2285 0.00
crit 0.3 28.49% 5709.38 5460 6209 1123.47 0 6209 1819 1819 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 24698 2.4% 6.2 76.65sec 375396 118803 Periodic 30.6 59169 118331 75819 28.1% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 0.00 30.57 30.57 3.1599 0.6382 2317962.09 3407623.84 31.98 118802.83 118802.83
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.0 71.85% 59168.67 55695 63339 59175.05 57333 61571 1299781 1910801 31.98
crit 8.6 28.15% 118330.64 111390 126678 118325.21 0 125950 1018181 1496823 31.97
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 13016 1.2% 8.6 52.47sec 142152 0 Direct 8.6 110798 221559 142155 28.3% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.58 8.58 0.00 0.00 0.0000 0.0000 1219078.04 1792160.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.15 71.69% 110798.44 101364 115276 110814.92 103351 115276 681214 1001449 31.98
crit 2.43 28.31% 221559.19 202727 230553 208201.45 0 230553 537864 790712 30.05
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 14865 1.4% 0.0 0.00sec 0 0 Direct 6.1 178564 357172 229699 28.6% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.07 0.00 0.00 0.0000 0.0000 1395296.19 2051217.57 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.33 71.36% 178564.26 163673 186138 178333.66 0 186138 774011 1137870 31.94
crit 1.74 28.64% 357171.60 327346 372276 310963.51 0 372276 621285 913348 27.84
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7503 0.7% 0.0 0.00sec 0 0 Direct 6.1 90223 180568 115932 28.5% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.07 0.00 0.00 0.0000 0.0000 704199.69 1035240.24 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.35 71.54% 90222.60 83441 93069 90151.45 0 93069 392054 576356 31.96
crit 1.73 28.46% 180567.64 166882 186138 156966.65 0 186138 312146 458884 27.80
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 4002 0.4% 21.9 19.50sec 17122 0 Direct 21.9 13362 26731 17123 28.1% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.92 21.92 0.00 0.00 0.0000 0.0000 375328.78 551768.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.75 71.87% 13361.96 12253 13935 13362.51 12940 13743 210517 309480 31.98
crit 6.17 28.13% 26730.77 24506 27870 26707.03 0 27870 164812 242289 31.95
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 11140 1.1% 5.7 82.22sec 184985 311524 Periodic 16.5 49303 98618 63225 28.2% 0.0% 0.7%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 0.00 16.54 16.54 0.5938 0.2030 1045787.06 1537406.04 31.98 311524.30 311524.30
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.9 71.77% 49302.86 44888 50068 49296.48 47305 50068 585234 860350 31.98
crit 4.7 28.23% 98618.07 89777 100135 97947.08 0 100135 460553 677056 31.76
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
pet - earth_spirit 93730 / 19606
auto_attack_mh 4232 0.4% 41.5 10.13sec 9559 4625 Direct 41.5 8765 17530 9559 28.1% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.50 41.50 0.00 0.00 2.0667 0.0000 396737.58 583241.82 31.98 4625.27 4625.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.92 52.82% 8765.49 7923 9191 8765.92 8495 9056 192149 282477 31.98
crit 11.67 28.12% 17530.05 15846 18381 17530.33 16638 18381 204589 300765 31.98
miss 7.91 19.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 2117 0.2% 41.5 10.13sec 4782 2314 Direct 41.5 4383 8766 4782 28.2% 19.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.50 41.50 0.00 0.00 2.0667 0.0000 198459.15 291753.75 31.98 2313.69 2313.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.89 52.74% 4382.52 3961 4595 4382.73 4220 4535 95929 141025 31.98
crit 11.70 28.18% 8766.15 7923 9191 8766.38 8335 9164 102530 150729 31.98
miss 7.92 19.08% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blackout Kick 10253 1.0% 14.2 30.05sec 67715 0 Direct 14.2 52815 105605 67718 28.2% 0.0%  

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 0.00 0.00 0.0000 0.0000 960799.59 1412466.41 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.18 71.77% 52815.19 49011 55738 52808.78 49492 55601 537869 790718 31.98
crit 4.00 28.23% 105604.85 98022 111476 104311.43 0 111476 422931 621748 31.59
 
 

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:
  • description:Kick with a blast of Chi energy, dealing {$s1=0} Physical damage.
 
Chi Burst (_damage) 1923 0.2% 0.0 0.00sec 0 0 Direct 2.1 68845 137726 88206 28.1% 0.0%  

Stats details: chi_burst_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 2.05 0.00 0.00 0.0000 0.0000 180879.42 180879.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.47 71.89% 68844.93 64332 73162 59605.22 0 73162 101501 101501 0.00
crit 0.58 28.11% 137725.54 128663 146323 64773.60 0 146323 79379 79379 0.00
 
 

Action details: chi_burst_damage

Static Values
  • id:148135
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148135
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crackling Jade Lightning 44 0.0% 0.3 138.96sec 14616 0 Periodic 1.1 2858 5708 3664 28.3% 0.0% 0.2%

Stats details: crackling_jade_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.28 0.00 1.12 1.12 0.0000 0.8627 4097.21 4097.21 0.00 4250.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.8 71.71% 2857.78 2730 5947 747.62 0 4526 2292 2292 0.00
crit 0.3 28.29% 5708.01 5460 6209 1120.80 0 6209 1806 1806 0.00
 
 

Action details: crackling_jade_lightning

Static Values
  • id:117952
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117952
  • name:Crackling Jade Lightning
  • school:nature
  • tooltip:Taking $w1 damage every $t1 sec.
  • description:Channel Jade lightning, causing $o1 Nature damage over {$117952d=4 seconds} to the target$?a154436[, generating 1 Chi each time it deals damage,][] and sometimes knocking back melee attackers.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.175000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fists of Fury 24708 2.4% 6.2 76.65sec 375463 118824 Periodic 30.6 59168 118333 75833 28.2% 0.0% 4.3%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 0.00 30.57 30.57 3.1599 0.6382 2318377.44 3408234.45 31.98 118824.12 118824.12
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.0 71.83% 59168.29 55695 63339 59173.53 57132 61623 1299366 1910191 31.98
crit 8.6 28.17% 118332.58 111390 126678 118344.55 111390 126678 1019012 1498044 31.98
 
 

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w3 damage every $t3 sec. $?s125671[Parrying all attacks.][]
  • description:Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.17
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: fists_of_fury_tick

Static Values
  • id:117418
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:117418
  • name:Fists of Fury
  • school:physical
  • tooltip:
  • description:{$@spelldesc113656=Pummels all targets in front of you, dealing ${5*{$s5=0}} damage over {$113656d=4 seconds}. Can be channeled while moving.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rising Sun Kick 13005 1.2% 8.6 52.47sec 142064 0 Direct 8.6 110783 221637 142068 28.2% 0.0%  

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.58 8.58 0.00 0.00 0.0000 0.0000 1218323.30 1791050.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.16 71.78% 110783.06 101364 115276 110783.06 0 115276 681968 1002558 31.97
crit 2.42 28.22% 221637.32 202727 230553 208145.65 0 230553 536355 788492 30.02
 
 

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:
  • description:Kick upwards, dealing {$185099s1=0} damage{$?s128595=false}[, and reducing the effectiveness of healing on the target for {$115804d=10 seconds}][].
 
Strike of the Windlord 14815 1.4% 0.0 0.00sec 0 0 Direct 6.1 178576 357110 228941 28.2% 0.0%  

Stats details: strike_of_the_windlord

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.07 0.00 0.00 0.0000 0.0000 1390564.28 2044261.21 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.36 71.79% 178576.46 163673 186138 178381.59 0 186138 778743 1144826 31.95
crit 1.71 28.21% 357110.18 327346 372276 308330.35 0 372276 611821 899435 27.60
 
 

Action details: strike_of_the_windlord

Static Values
  • id:222029
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222029
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Strike of the Windlord (_offhand) 7501 0.7% 0.0 0.00sec 0 0 Direct 6.1 90240 180481 115899 28.4% 0.0%  

Stats details: strike_of_the_windlord_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.07 0.00 0.00 0.0000 0.0000 704015.13 1034968.93 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.35 71.56% 90239.86 83441 93069 90136.16 0 93069 392238 576628 31.95
crit 1.73 28.44% 180480.87 166882 186138 156678.64 0 186138 311777 458341 27.75
 
 

Action details: strike_of_the_windlord_offhand

Static Values
  • id:205414
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205414
  • name:Strike of the Windlord
  • school:physical
  • tooltip:
  • description:{$@spelldesc205320=Strike with both |cFFFFCC99Fists of the Heavens|r at all enemies in front of you, dealing ${$222029sw1+$205414sw1} damage and reducing movement speed by {$s2=50}% for {$d=6 seconds}.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:22.50
 
Tiger Palm 4005 0.4% 21.9 19.50sec 17137 0 Direct 21.9 13363 26728 17136 28.2% 0.0%  

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.92 21.92 0.00 0.00 0.0000 0.0000 375647.11 552236.83 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.73 71.76% 13362.55 12253 13935 13362.72 12867 13760 210199 309012 31.98
crit 6.19 28.24% 26727.75 24506 27870 26709.77 0 27870 165448 243225 31.96
 
 

Action details: tiger_palm

Static Values
  • id:100780
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100780
  • name:Tiger Palm
  • school:physical
  • tooltip:
  • description:Attack with the palm of your hand, dealing {$s1=1} damage.$?a137025[ Tiger Palm has an $137384m1% chance to make your next Blackout Kick cost no Chi.][]$?a137023[ Reduces the remaining cooldown on your Brews by {$s3=1} sec.][]$?a137025[ |cFFFFFFFFGenerates {$s2=1} Chi.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.050000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Whirling Dragon Punch 11127 1.1% 5.7 82.22sec 184756 311138 Periodic 16.5 49301 98629 63150 28.1% 0.0% 0.7%

Stats details: whirling_dragon_punch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 0.00 16.54 16.54 0.5938 0.2030 1044490.61 1535500.13 31.98 311138.10 311138.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.9 71.93% 49300.71 44888 50068 49292.73 47286 50068 586531 862255 31.98
crit 4.6 28.07% 98629.16 89777 100135 97839.99 0 100135 457960 673245 31.72
 
 

Action details: whirling_dragon_punch

Static Values
  • id:152175
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:152175
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: whirling_dragon_punch_tick

Static Values
  • id:158221
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:158221
  • name:Whirling Dragon Punch
  • school:physical
  • tooltip:
  • description:{$@spelldesc152175=Performs a devastating whirling upward strike, dealing ${3*{$158221s1=0}} damage to all nearby enemies. Only usable while Fists of Fury and Rising Sun Kick are on cooldown.}
 
Simple Action Stats Execute Interval
Müjnir
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
 
Chi Burst 13.6 33.00sec

Stats details: chi_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.64 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst

Static Values
  • id:123986
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy.time_to_max>=2.25
Spelldata
  • id:123986
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]
 
Chi Burst (_heal) 13.6 33.00sec

Stats details: chi_burst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 13.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst_heal

Static Values
  • id:130654
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
Spelldata
  • id:130654
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:{$@spelldesc123986=Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]}
 
Energizing Elixir 7.9 61.09sec

Stats details: energizing_elixir

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: energizing_elixir

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:115288
  • name:Energizing Elixir
  • school:physical
  • tooltip:
  • description:Chug an Energizing Elixir, refilling all your Energy and Chi.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Müjnir
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Storm, Earth, and Fire 7.4 63.28sec

Stats details: storm_earth_and_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: storm_earth_and_fire

Static Values
  • id:137639
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:137639
  • name:Storm, Earth, and Fire
  • school:nature
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
 
pet - fire_spirit
Chi Burst 2.1 147.93sec

Stats details: chi_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst

Static Values
  • id:123986
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123986
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]
 
pet - earth_spirit
Chi Burst 2.1 147.93sec

Stats details: chi_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chi_burst

Static Values
  • id:123986
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123986
  • name:Chi Burst
  • school:nature
  • tooltip:
  • description:Hurls a torrent of Chi energy up to 40 yds forward, dealing $<damage> Nature damage to all enemies, and $<healing> healing to the Monk and all allies in its path.$?c1[ Casting Chi Burst does not prevent avoiding attacks.][]
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 8.28% 0.0(0.0) 1.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blackout Kick! (bok_proc) 17.5 0.0 24.5sec 24.5sec 8.14% 3.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_bok_proc
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:16.00%
  • default_value:-0.00

Stack Uptimes

  • bok_proc_1:8.14%

Trigger Attempt Success

  • trigger_pct:15.95%

Spelldata details

  • id:116768
  • name:Blackout Kick!
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:{$@spelldesc137384=You have a $m1% chance when you Tiger Palm to cause your next Blackout Kick to cost no Chi within {$116768d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Hit Combo 1.0 312.1 0.0sec 1.4sec 100.00% 99.88% 305.1(305.1) 0.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • hit_combo_1:0.23%
  • hit_combo_2:0.34%
  • hit_combo_3:0.66%
  • hit_combo_4:0.23%
  • hit_combo_5:0.23%
  • hit_combo_6:0.39%
  • hit_combo_7:0.23%
  • hit_combo_8:97.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 116.2sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Storm, Earth, and Fire 6.4 6.4 75.1sec 34.4sec 20.92% 27.20% 0.0(0.0) 6.2

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_storm_earth_and_fire
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_earth_and_fire_2:20.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137639
  • name:Storm, Earth, and Fire
  • tooltip:Elemental spirits summoned, mirroring all of the Monk's attacks. The Monk and spirits each do ${100+$m1}% of normal damage and healing.
  • description:Split into 3 elemental spirits for {$d=15 seconds}, each spirit dealing ${100+$m1}% of normal damage and healing. You directly control the Storm spirit, while Earth and Fire spirits mimic your attacks on nearby enemies. While active, casting Storm, Earth, and Fire again will cause the spirits to fixate on your target.
  • max_stacks:2
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
(sef_) earth_spirit: Hit Combo 6.3 64.6 75.2sec 5.9sec 98.26% 95.58% 20.8(20.8) 0.0

Buff details

  • buff initial source:Müjnir_earth_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:9.13%
  • sef_hit_combo_2:9.99%
  • sef_hit_combo_3:13.32%
  • sef_hit_combo_4:9.86%
  • sef_hit_combo_5:9.38%
  • sef_hit_combo_6:9.64%
  • sef_hit_combo_7:8.34%
  • sef_hit_combo_8:28.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
(sef_) fire_spirit: Hit Combo 6.3 64.6 75.2sec 5.9sec 98.26% 95.58% 20.8(20.8) 0.0

Buff details

  • buff initial source:Müjnir_fire_spirit
  • cooldown name:buff_sef_hit_combo
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • sef_hit_combo_1:9.13%
  • sef_hit_combo_2:9.99%
  • sef_hit_combo_3:13.32%
  • sef_hit_combo_4:9.86%
  • sef_hit_combo_5:9.38%
  • sef_hit_combo_6:9.64%
  • sef_hit_combo_7:8.34%
  • sef_hit_combo_8:28.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196741
  • name:Hit Combo
  • tooltip:Damage dealt increased by {$s1=2}%.
  • description:{$@spelldesc196740=Each successive attack that triggers Combo Strikes in a row grants {$196741s1=2}% increased damage, stacking up to {$196741u=8} times.}
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windwalking (_movement_aura)

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_windwalking_movement_aura
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • windwalking_movement_aura_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:166646
  • name:Windwalking
  • tooltip:Movement speed increased by {$s1=10}%.
  • description:
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Müjnir
blackout_kick Chi 87.5 70.1 0.8 0.8 180644.8
fists_of_fury Chi 21.3 63.9 3.0 3.0 310337.8
rising_sun_kick Chi 42.9 85.9 2.0 2.0 146114.7
strike_of_the_windlord Chi 11.3 22.6 2.0 2.0 355201.0
tiger_palm Energy 109.9 5494.1 50.0 50.0 706.2
Resource Gains Type Count Total Average Overflow
tiger_palm Chi 109.88 211.11 (80.66%) 1.92 8.66 3.94%
energy_regen Energy 1469.04 4994.46 (92.08%) 3.40 346.32 6.48%
mp5_regen Mana 1469.04 0.00 (0.00%) 0.00 3962395.88 100.00%
blackout_kick_proc Chi 17.45 17.45 (6.67%) 1.00 0.00 0.00%
energizing_elixir_energy Energy 7.88 429.36 (7.92%) 54.46 1147.48 72.77%
energizing_elixir_chi Chi 7.88 33.17 (12.67%) 4.21 45.68 57.93%
pet - fire_spirit
tiger_palm Chi 21.92 0.00 (0.00%) 0.00 21.92 100.00%
pet - earth_spirit
tiger_palm Chi 21.92 0.00 (0.00%) 0.00 21.92 100.00%
Resource RPS-Gain RPS-Loss
Energy 12.04 12.19
Chi 0.54 0.54
Combat End Resource Mean Min Max
Energy 39.62 0.02 110.00
Chi 1.82 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 6.1%

Procs

Count Interval
bok_proc 17.5 24.5sec

Statistics & Data Analysis

Fight Length
Sample Data Müjnir Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Müjnir Damage Per Second
Count 9999
Mean 218965.05
Minimum 202765.30
Maximum 238761.67
Spread ( max - min ) 35996.37
Range [ ( max - min ) / 2 * 100% ] 8.22%
Standard Deviation 4540.9795
5th Percentile 211829.51
95th Percentile 226670.60
( 95th Percentile - 5th Percentile ) 14841.08
Mean Distribution
Standard Deviation 45.4121
95.00% Confidence Intervall ( 218876.05 - 219054.06 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1652
0.1 Scale Factor Error with Delta=300 176028
0.05 Scale Factor Error with Delta=300 704113
0.01 Scale Factor Error with Delta=300 17602840
Priority Target DPS
Sample Data Müjnir Priority Target Damage Per Second
Count 9999
Mean 218965.05
Minimum 202765.30
Maximum 238761.67
Spread ( max - min ) 35996.37
Range [ ( max - min ) / 2 * 100% ] 8.22%
Standard Deviation 4540.9795
5th Percentile 211829.51
95th Percentile 226670.60
( 95th Percentile - 5th Percentile ) 14841.08
Mean Distribution
Standard Deviation 45.4121
95.00% Confidence Intervall ( 218876.05 - 219054.06 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1652
0.1 Scale Factor Error with Delta=300 176028
0.05 Scale Factor Error with Delta=300 704113
0.01 Scale Factor Error with Delta=300 17602840
DPS(e)
Sample Data Müjnir Damage Per Second (Effective)
Count 9999
Mean 218965.05
Minimum 202765.30
Maximum 238761.67
Spread ( max - min ) 35996.37
Range [ ( max - min ) / 2 * 100% ] 8.22%
Damage
Sample Data Müjnir Damage
Count 9999
Mean 80961320.64
Minimum 60196429.33
Maximum 103077887.54
Spread ( max - min ) 42881458.21
Range [ ( max - min ) / 2 * 100% ] 26.48%
DTPS
Sample Data Müjnir Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Müjnir Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Müjnir Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Müjnir Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Müjnir Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Müjnir Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MüjnirTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Müjnir Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Total Stagger damage generated
Sample Data Total Stagger damage generated
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was not purified
Sample Data Stagger damage that was not purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Stagger damage that was purified
Sample Data Stagger damage that was purified
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at light stagger
Sample Data Amount of damage purified while at light stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at moderate stagger
Sample Data Amount of damage purified while at moderate stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Amount of damage purified while at heavy stagger
Sample Data Amount of damage purified while at heavy stagger
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 potion,name=old_war,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
7 0.00 call_action_list,name=serenity,if=talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.rising_sun_kick.remains<=4)|buff.serenity.up)
8 0.00 call_action_list,name=sef,if=!talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.fists_of_fury.remains<=6&cooldown.rising_sun_kick.remains<=6)|buff.storm_earth_and_fire.up)
9 0.00 call_action_list,name=serenity,if=(!artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=15&cooldown.rising_sun_kick.remains<7)|buff.serenity.up
A 0.00 call_action_list,name=sef,if=!talent.serenity.enabled&((!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5)|buff.storm_earth_and_fire.up)
B 0.00 call_action_list,name=st
actions.cd
# count action,conditions
0.00 invoke_xuen
0.00 blood_fury
0.00 berserking
0.00 touch_of_death,cycle_targets=1,max_cycle_targets=2,if=!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
C 4.31 touch_of_death,if=!artifact.gale_burst.enabled&!equipped.137057
0.00 touch_of_death,cycle_targets=1,max_cycle_targets=2,if=artifact.gale_burst.enabled&equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7&!prev_gcd.touch_of_death
0.00 touch_of_death,if=artifact.gale_burst.enabled&!equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7
actions.sef
# count action,conditions
D 3.07 energizing_elixir
0.00 arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
E 0.00 call_action_list,name=cd
F 7.35 storm_earth_and_fire
G 0.00 call_action_list,name=st
actions.st
# count action,conditions
I 0.00 call_action_list,name=cd
0.00 arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
J 4.81 energizing_elixir,if=energy<energy.max&chi<=1
K 11.30 strike_of_the_windlord,if=talent.serenity.enabled|active_enemies<6
L 21.30 fists_of_fury
M 42.93 rising_sun_kick,cycle_targets=1
N 20.96 whirling_dragon_punch
0.00 spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
0.00 rushing_jade_wind,if=chi.max-chi>1&!prev_gcd.rushing_jade_wind
O 87.55 blackout_kick,cycle_targets=1,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick
0.00 chi_wave,if=energy.time_to_max>=2.25
P 13.66 chi_burst,if=energy.time_to_max>=2.25
Q 109.88 tiger_palm,cycle_targets=1,if=!prev_gcd.tiger_palm
0.00 crackling_jade_lightning,interrupt=1,if=talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
R 1.24 crackling_jade_lightning,interrupt=1,if=!talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1

Sample Sequence

0245DCFKFLQMNQOQOMQOPOQLQMNQOQOFMQOQOLQMNQKQOPQMQOQLJMNOQOQOQMOQOQLMNQKOPQMOQOQOQLQMNQOQOMQF6OPODCLKQMNOQOQOQMOQOQLQMNPQOQOMOQOKQMQOQLQMJNOQOPOQMOQFOQORLQMNQOKQOQMOQOPOQLOQMNQOQOMQOQLCJMKNQOPOQMQOQOLQMQONQOMQOFQOPMQOKQOQLQMNQOJQOMOQOQOPLQMNQOQOQKMOQOQLQMNQOPQOMQOQLQMNCJOQKOQMOQOQOPLQMNQOQOMQOFQOLQMNQKPQOQMQOQLJMNOQOQOQMOQOPOQLQKQMN

Sample Sequence Table

time name target resources buffs
Pre flask Müjnir 110.0/110: 100% energy | 5.0/5: 100% chi
Pre augmentation Müjnir 110.0/110: 100% energy | 5.0/5: 100% chi
Pre potion Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi potion_of_the_old_war
0:00.000 energizing_elixir Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi potion_of_the_old_war
0:00.000 touch_of_death Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi potion_of_the_old_war
0:01.005 storm_earth_and_fire Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi bloodlust, hit_combo, potion_of_the_old_war
0:01.005 strike_of_the_windlord Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi bloodlust, hit_combo, storm_earth_and_fire(2), potion_of_the_old_war
0:02.510 storm_earth_and_fire Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), potion_of_the_old_war
0:02.510 fists_of_fury Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi bloodlust, hit_combo(2), storm_earth_and_fire(2), potion_of_the_old_war
0:05.398 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(3), storm_earth_and_fire(2), potion_of_the_old_war
0:06.404 rising_sun_kick Fluffy_Pillow 75.1/110: 68% energy | 2.0/5: 40% chi bloodlust, hit_combo(4), storm_earth_and_fire(2), potion_of_the_old_war
0:07.409 whirling_dragon_punch Fluffy_Pillow 90.2/110: 82% energy | 0.0/5: 0% chi bloodlust, hit_combo(5), storm_earth_and_fire(2), potion_of_the_old_war
0:09.084 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi bloodlust, hit_combo(6), storm_earth_and_fire(2), potion_of_the_old_war
0:10.088 blackout_kick Fluffy_Pillow 75.1/110: 68% energy | 2.0/5: 40% chi bloodlust, hit_combo(7), storm_earth_and_fire(2), potion_of_the_old_war
0:11.092 tiger_palm Fluffy_Pillow 90.1/110: 82% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:12.096 blackout_kick Fluffy_Pillow 55.2/110: 50% energy | 3.0/5: 60% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:13.101 rising_sun_kick Fluffy_Pillow 70.3/110: 64% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:14.107 tiger_palm Fluffy_Pillow 85.4/110: 78% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:15.111 blackout_kick Fluffy_Pillow 50.5/110: 46% energy | 3.0/5: 60% chi bloodlust, bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
0:16.116 chi_burst Fluffy_Pillow 65.6/110: 60% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:17.121 blackout_kick Fluffy_Pillow 80.7/110: 73% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:18.124 tiger_palm Fluffy_Pillow 95.7/110: 87% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:19.130 fists_of_fury Fluffy_Pillow 60.8/110: 55% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:22.030 tiger_palm Fluffy_Pillow 104.4/110: 95% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), potion_of_the_old_war
0:23.035 rising_sun_kick Fluffy_Pillow 69.5/110: 63% energy | 3.0/5: 60% chi bloodlust, hit_combo(8)
0:24.041 whirling_dragon_punch Fluffy_Pillow 84.6/110: 77% energy | 1.0/5: 20% chi bloodlust, hit_combo(8)
0:25.893 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 1.0/5: 20% chi bloodlust, hit_combo(8)
0:26.895 blackout_kick Fluffy_Pillow 75.0/110: 68% energy | 3.0/5: 60% chi bloodlust, hit_combo(8)
0:27.898 tiger_palm Fluffy_Pillow 90.1/110: 82% energy | 2.0/5: 40% chi bloodlust, hit_combo(8)
0:28.902 blackout_kick Fluffy_Pillow 55.2/110: 50% energy | 4.0/5: 80% chi bloodlust, hit_combo(8)
0:29.909 storm_earth_and_fire Fluffy_Pillow 70.3/110: 64% energy | 3.0/5: 60% chi bloodlust, hit_combo(8)
0:29.909 rising_sun_kick Fluffy_Pillow 70.3/110: 64% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:30.914 tiger_palm Fluffy_Pillow 85.4/110: 78% energy | 1.0/5: 20% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:31.919 blackout_kick Fluffy_Pillow 50.5/110: 46% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:32.924 tiger_palm Fluffy_Pillow 65.6/110: 60% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:33.929 blackout_kick Fluffy_Pillow 30.7/110: 28% energy | 4.0/5: 80% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:34.933 fists_of_fury Fluffy_Pillow 45.7/110: 42% energy | 3.0/5: 60% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:38.027 tiger_palm Fluffy_Pillow 92.2/110: 84% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:39.032 rising_sun_kick Fluffy_Pillow 57.3/110: 52% energy | 2.0/5: 40% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:40.037 whirling_dragon_punch Fluffy_Pillow 72.4/110: 66% energy | 0.0/5: 0% chi bloodlust, hit_combo(8), storm_earth_and_fire(2)
0:41.856 tiger_palm Fluffy_Pillow 96.5/110: 88% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
0:42.860 strike_of_the_windlord Fluffy_Pillow 58.1/110: 53% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
0:44.367 tiger_palm Fluffy_Pillow 75.5/110: 69% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
0:45.372 blackout_kick Fluffy_Pillow 37.1/110: 34% energy | 2.0/5: 40% chi hit_combo(8)
0:46.376 Waiting 0.200 sec 48.7/110: 44% energy | 1.0/5: 20% chi hit_combo(8)
0:46.576 chi_burst Fluffy_Pillow 51.1/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
0:47.787 tiger_palm Fluffy_Pillow 65.0/110: 59% energy | 1.0/5: 20% chi hit_combo(8)
0:48.791 rising_sun_kick Fluffy_Pillow 26.6/110: 24% energy | 3.0/5: 60% chi hit_combo(8)
0:49.796 Waiting 1.100 sec 38.2/110: 35% energy | 1.0/5: 20% chi hit_combo(8)
0:50.896 tiger_palm Fluffy_Pillow 50.9/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
0:51.900 blackout_kick Fluffy_Pillow 12.5/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
0:52.904 Waiting 2.300 sec 24.1/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
0:55.204 tiger_palm Fluffy_Pillow 50.7/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
0:56.210 fists_of_fury Fluffy_Pillow 12.3/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
0:59.839 energizing_elixir Fluffy_Pillow 54.2/110: 49% energy | 1.0/5: 20% chi hit_combo(8)
1:00.000 rising_sun_kick Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
1:01.004 whirling_dragon_punch Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi hit_combo(8)
1:02.727 blackout_kick Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi hit_combo(8)
1:03.733 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 2.0/5: 40% chi hit_combo(8)
1:04.737 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 4.0/5: 80% chi hit_combo(8)
1:05.742 tiger_palm Fluffy_Pillow 83.2/110: 76% energy | 3.0/5: 60% chi hit_combo(8)
1:06.745 blackout_kick Fluffy_Pillow 44.8/110: 41% energy | 5.0/5: 100% chi hit_combo(8)
1:07.750 tiger_palm Fluffy_Pillow 56.4/110: 51% energy | 4.0/5: 80% chi hit_combo(8)
1:08.756 rising_sun_kick Fluffy_Pillow 18.0/110: 16% energy | 5.0/5: 100% chi hit_combo(8)
1:09.759 blackout_kick Fluffy_Pillow 29.6/110: 27% energy | 3.0/5: 60% chi hit_combo(8)
1:10.765 Waiting 0.800 sec 41.2/110: 37% energy | 2.0/5: 40% chi hit_combo(8)
1:11.565 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
1:12.569 blackout_kick Fluffy_Pillow 12.0/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
1:13.573 Waiting 2.300 sec 23.6/110: 21% energy | 3.0/5: 60% chi hit_combo(8)
1:15.873 tiger_palm Fluffy_Pillow 50.2/110: 46% energy | 3.0/5: 60% chi hit_combo(8)
1:16.877 fists_of_fury Fluffy_Pillow 11.8/110: 11% energy | 5.0/5: 100% chi hit_combo(8)
1:20.559 rising_sun_kick Fluffy_Pillow 54.3/110: 49% energy | 2.0/5: 40% chi hit_combo(8)
1:21.564 whirling_dragon_punch Fluffy_Pillow 65.9/110: 60% energy | 0.0/5: 0% chi hit_combo(8)
1:23.618 tiger_palm Fluffy_Pillow 89.7/110: 82% energy | 0.0/5: 0% chi hit_combo(8)
1:24.622 strike_of_the_windlord Fluffy_Pillow 51.3/110: 47% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
1:26.129 blackout_kick Fluffy_Pillow 68.7/110: 62% energy | 0.0/5: 0% chi bok_proc, hit_combo(8)
1:27.135 chi_burst Fluffy_Pillow 80.3/110: 73% energy | 0.0/5: 0% chi hit_combo(8)
1:28.139 tiger_palm Fluffy_Pillow 91.9/110: 84% energy | 0.0/5: 0% chi hit_combo(8)
1:29.144 rising_sun_kick Fluffy_Pillow 53.5/110: 49% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
1:30.221 blackout_kick Fluffy_Pillow 65.9/110: 60% energy | 0.0/5: 0% chi bok_proc, hit_combo(8)
1:31.224 tiger_palm Fluffy_Pillow 77.5/110: 70% energy | 0.0/5: 0% chi hit_combo(8)
1:32.229 blackout_kick Fluffy_Pillow 39.1/110: 36% energy | 2.0/5: 40% chi hit_combo(8)
1:33.234 tiger_palm Fluffy_Pillow 50.7/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
1:34.239 blackout_kick Fluffy_Pillow 12.3/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
1:35.243 Waiting 2.300 sec 23.9/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
1:37.543 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
1:38.547 fists_of_fury Fluffy_Pillow 12.1/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
1:42.262 tiger_palm Fluffy_Pillow 55.0/110: 50% energy | 1.0/5: 20% chi hit_combo(8)
1:43.266 rising_sun_kick Fluffy_Pillow 16.6/110: 15% energy | 3.0/5: 60% chi hit_combo(8)
1:44.268 whirling_dragon_punch Fluffy_Pillow 28.1/110: 26% energy | 1.0/5: 20% chi hit_combo(8)
1:45.906 Waiting 0.300 sec 47.1/110: 43% energy | 1.0/5: 20% chi hit_combo(8)
1:46.206 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
1:47.211 blackout_kick Fluffy_Pillow 12.1/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
1:48.217 Waiting 2.300 sec 23.8/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
1:50.517 tiger_palm Fluffy_Pillow 50.3/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
1:51.521 blackout_kick Fluffy_Pillow 11.9/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
1:52.525 rising_sun_kick Fluffy_Pillow 23.5/110: 21% energy | 3.0/5: 60% chi hit_combo(8)
1:53.529 Waiting 1.300 sec 35.1/110: 32% energy | 1.0/5: 20% chi hit_combo(8)
1:54.829 tiger_palm Fluffy_Pillow 50.1/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
1:55.834 storm_earth_and_fire Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
1:55.834 potion Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
1:55.834 blackout_kick Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:56.840 Waiting 1.000 sec 23.3/110: 21% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:57.840 chi_burst Fluffy_Pillow 34.9/110: 32% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
1:59.006 blackout_kick Fluffy_Pillow 48.4/110: 44% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:00.010 energizing_elixir Fluffy_Pillow 60.0/110: 55% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:00.010 touch_of_death Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:01.013 fists_of_fury Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:04.721 strike_of_the_windlord Fluffy_Pillow 110.0/110: 100% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:06.227 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:07.231 rising_sun_kick Fluffy_Pillow 71.6/110: 65% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:08.234 whirling_dragon_punch Fluffy_Pillow 83.2/110: 76% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:09.942 blackout_kick Fluffy_Pillow 102.9/110: 94% energy | 0.0/5: 0% chi bok_proc, hit_combo(8), storm_earth_and_fire(2), potion_of_the_old_war
2:10.947 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 0.0/5: 0% chi hit_combo(8), potion_of_the_old_war
2:11.952 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 2.0/5: 40% chi hit_combo(8), potion_of_the_old_war
2:12.957 tiger_palm Fluffy_Pillow 83.2/110: 76% energy | 1.0/5: 20% chi hit_combo(8), potion_of_the_old_war
2:13.962 blackout_kick Fluffy_Pillow 44.8/110: 41% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:14.968 tiger_palm Fluffy_Pillow 56.4/110: 51% energy | 2.0/5: 40% chi hit_combo(8), potion_of_the_old_war
2:15.973 rising_sun_kick Fluffy_Pillow 18.0/110: 16% energy | 4.0/5: 80% chi hit_combo(8), potion_of_the_old_war
2:16.977 blackout_kick Fluffy_Pillow 29.6/110: 27% energy | 2.0/5: 40% chi hit_combo(8), potion_of_the_old_war
2:17.980 Waiting 0.800 sec 41.2/110: 37% energy | 1.0/5: 20% chi hit_combo(8), potion_of_the_old_war
2:18.780 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 1.0/5: 20% chi hit_combo(8), potion_of_the_old_war
2:19.782 blackout_kick Fluffy_Pillow 12.0/110: 11% energy | 3.0/5: 60% chi hit_combo(8), potion_of_the_old_war
2:20.788 Waiting 2.300 sec 23.7/110: 22% energy | 2.0/5: 40% chi hit_combo(8), potion_of_the_old_war
2:23.088 tiger_palm Fluffy_Pillow 50.2/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
2:24.092 fists_of_fury Fluffy_Pillow 11.8/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
2:27.731 tiger_palm Fluffy_Pillow 53.8/110: 49% energy | 1.0/5: 20% chi hit_combo(8)
2:28.735 rising_sun_kick Fluffy_Pillow 15.4/110: 14% energy | 3.0/5: 60% chi hit_combo(8)
2:29.740 whirling_dragon_punch Fluffy_Pillow 27.0/110: 25% energy | 1.0/5: 20% chi hit_combo(8)
2:31.524 chi_burst Fluffy_Pillow 47.6/110: 43% energy | 1.0/5: 20% chi hit_combo(8)
2:32.527 tiger_palm Fluffy_Pillow 59.2/110: 54% energy | 1.0/5: 20% chi hit_combo(8)
2:33.531 blackout_kick Fluffy_Pillow 20.8/110: 19% energy | 3.0/5: 60% chi hit_combo(8)
2:34.536 Waiting 1.600 sec 32.4/110: 29% energy | 2.0/5: 40% chi hit_combo(8)
2:36.136 tiger_palm Fluffy_Pillow 50.9/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
2:37.141 blackout_kick Fluffy_Pillow 12.5/110: 11% energy | 4.0/5: 80% chi bok_proc, hit_combo(8)
2:38.146 rising_sun_kick Fluffy_Pillow 24.1/110: 22% energy | 4.0/5: 80% chi hit_combo(8)
2:39.150 blackout_kick Fluffy_Pillow 35.7/110: 32% energy | 2.0/5: 40% chi hit_combo(8)
2:40.155 Waiting 0.300 sec 47.3/110: 43% energy | 1.0/5: 20% chi hit_combo(8)
2:40.455 tiger_palm Fluffy_Pillow 50.8/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
2:41.458 blackout_kick Fluffy_Pillow 12.4/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
2:42.463 Waiting 2.100 sec 24.0/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
2:44.563 strike_of_the_windlord Fluffy_Pillow 48.2/110: 44% energy | 2.0/5: 40% chi hit_combo(8)
2:46.227 tiger_palm Fluffy_Pillow 67.5/110: 61% energy | 0.0/5: 0% chi hit_combo(8)
2:47.232 rising_sun_kick Fluffy_Pillow 29.1/110: 26% energy | 2.0/5: 40% chi hit_combo(8)
2:48.239 Waiting 0.900 sec 40.7/110: 37% energy | 0.0/5: 0% chi hit_combo(8)
2:49.139 tiger_palm Fluffy_Pillow 51.1/110: 46% energy | 0.0/5: 0% chi hit_combo(8)
2:50.142 blackout_kick Fluffy_Pillow 12.7/110: 12% energy | 2.0/5: 40% chi hit_combo(8)
2:51.145 Waiting 2.300 sec 24.3/110: 22% energy | 1.0/5: 20% chi hit_combo(8)
2:53.445 tiger_palm Fluffy_Pillow 50.8/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
2:54.449 fists_of_fury Fluffy_Pillow 12.4/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
2:58.034 tiger_palm Fluffy_Pillow 53.8/110: 49% energy | 0.0/5: 0% chi hit_combo(8)
2:59.040 rising_sun_kick Fluffy_Pillow 15.4/110: 14% energy | 2.0/5: 40% chi hit_combo(8)
3:00.045 energizing_elixir Fluffy_Pillow 27.0/110: 25% energy | 0.0/5: 0% chi hit_combo(8)
3:00.045 whirling_dragon_punch Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
3:01.859 blackout_kick Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
3:02.864 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 4.0/5: 80% chi hit_combo(8)
3:03.869 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 5.0/5: 100% chi hit_combo(8)
3:04.872 chi_burst Fluffy_Pillow 83.2/110: 76% energy | 4.0/5: 80% chi hit_combo(8)
3:05.875 blackout_kick Fluffy_Pillow 94.8/110: 86% energy | 4.0/5: 80% chi hit_combo(8)
3:06.879 tiger_palm Fluffy_Pillow 106.4/110: 97% energy | 3.0/5: 60% chi hit_combo(8)
3:07.884 rising_sun_kick Fluffy_Pillow 68.0/110: 62% energy | 5.0/5: 100% chi hit_combo(8)
3:08.887 blackout_kick Fluffy_Pillow 79.6/110: 72% energy | 3.0/5: 60% chi hit_combo(8)
3:09.891 tiger_palm Fluffy_Pillow 91.2/110: 83% energy | 2.0/5: 40% chi hit_combo(8)
3:10.895 storm_earth_and_fire Fluffy_Pillow 52.8/110: 48% energy | 4.0/5: 80% chi hit_combo(8)
3:10.895 blackout_kick Fluffy_Pillow 52.8/110: 48% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
3:11.899 tiger_palm Fluffy_Pillow 64.3/110: 58% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:12.903 blackout_kick Fluffy_Pillow 25.9/110: 24% energy | 5.0/5: 100% chi hit_combo(8), storm_earth_and_fire(2)
3:13.909 crackling_jade_lightning Fluffy_Pillow 37.6/110: 34% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
3:15.929 fists_of_fury Fluffy_Pillow 60.9/110: 55% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
3:19.609 tiger_palm Fluffy_Pillow 103.4/110: 94% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:20.614 rising_sun_kick Fluffy_Pillow 65.0/110: 59% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:21.621 whirling_dragon_punch Fluffy_Pillow 76.6/110: 70% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:23.332 tiger_palm Fluffy_Pillow 96.4/110: 88% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
3:24.336 blackout_kick Fluffy_Pillow 58.0/110: 53% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
3:25.342 strike_of_the_windlord Fluffy_Pillow 69.6/110: 63% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
3:26.848 tiger_palm Fluffy_Pillow 87.0/110: 79% energy | 0.0/5: 0% chi hit_combo(8)
3:27.853 blackout_kick Fluffy_Pillow 48.6/110: 44% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
3:28.857 tiger_palm Fluffy_Pillow 60.2/110: 55% energy | 2.0/5: 40% chi hit_combo(8)
3:29.861 rising_sun_kick Fluffy_Pillow 21.8/110: 20% energy | 4.0/5: 80% chi hit_combo(8)
3:30.864 blackout_kick Fluffy_Pillow 33.4/110: 30% energy | 2.0/5: 40% chi hit_combo(8)
3:31.868 Waiting 0.500 sec 45.0/110: 41% energy | 1.0/5: 20% chi hit_combo(8)
3:32.368 tiger_palm Fluffy_Pillow 50.7/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
3:33.372 blackout_kick Fluffy_Pillow 12.3/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
3:34.375 Waiting 1.200 sec 23.9/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
3:35.575 chi_burst Fluffy_Pillow 37.8/110: 34% energy | 2.0/5: 40% chi hit_combo(8)
3:36.742 blackout_kick Fluffy_Pillow 51.3/110: 47% energy | 2.0/5: 40% chi hit_combo(8)
3:37.747 tiger_palm Fluffy_Pillow 62.9/110: 57% energy | 1.0/5: 20% chi hit_combo(8)
3:38.754 fists_of_fury Fluffy_Pillow 24.5/110: 22% energy | 3.0/5: 60% chi bok_proc, hit_combo(8)
3:42.538 blackout_kick Fluffy_Pillow 68.2/110: 62% energy | 0.0/5: 0% chi bok_proc, hit_combo(8)
3:43.542 tiger_palm Fluffy_Pillow 79.8/110: 73% energy | 0.0/5: 0% chi hit_combo(8)
3:44.546 rising_sun_kick Fluffy_Pillow 41.4/110: 38% energy | 2.0/5: 40% chi hit_combo(8)
3:45.552 whirling_dragon_punch Fluffy_Pillow 53.0/110: 48% energy | 0.0/5: 0% chi hit_combo(8)
3:47.324 tiger_palm Fluffy_Pillow 73.5/110: 67% energy | 0.0/5: 0% chi hit_combo(8)
3:48.328 blackout_kick Fluffy_Pillow 35.1/110: 32% energy | 2.0/5: 40% chi hit_combo(8)
3:49.333 Waiting 0.300 sec 46.7/110: 42% energy | 1.0/5: 20% chi hit_combo(8)
3:49.633 tiger_palm Fluffy_Pillow 50.1/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
3:50.637 blackout_kick Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
3:51.640 Waiting 1.400 sec 23.3/110: 21% energy | 2.0/5: 40% chi hit_combo(8)
3:53.040 rising_sun_kick Fluffy_Pillow 39.5/110: 36% energy | 2.0/5: 40% chi hit_combo(8)
3:54.209 tiger_palm Fluffy_Pillow 53.0/110: 48% energy | 0.0/5: 0% chi hit_combo(8)
3:55.214 blackout_kick Fluffy_Pillow 14.6/110: 13% energy | 2.0/5: 40% chi hit_combo(8)
3:56.217 Waiting 2.100 sec 26.2/110: 24% energy | 1.0/5: 20% chi hit_combo(8)
3:58.317 tiger_palm Fluffy_Pillow 50.4/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
3:59.322 fists_of_fury Fluffy_Pillow 12.0/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
4:03.173 touch_of_death Fluffy_Pillow 56.5/110: 51% energy | 0.0/5: 0% chi hit_combo(8)
4:04.176 energizing_elixir Fluffy_Pillow 68.1/110: 62% energy | 0.0/5: 0% chi hit_combo(8)
4:04.176 rising_sun_kick Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
4:05.180 strike_of_the_windlord Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi hit_combo(8)
4:06.849 whirling_dragon_punch Fluffy_Pillow 110.0/110: 100% energy | 1.0/5: 20% chi hit_combo(8)
4:08.558 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 1.0/5: 20% chi hit_combo(8)
4:09.562 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 3.0/5: 60% chi hit_combo(8)
4:10.568 chi_burst Fluffy_Pillow 83.2/110: 76% energy | 2.0/5: 40% chi hit_combo(8)
4:11.571 blackout_kick Fluffy_Pillow 94.8/110: 86% energy | 2.0/5: 40% chi hit_combo(8)
4:12.574 tiger_palm Fluffy_Pillow 106.4/110: 97% energy | 1.0/5: 20% chi hit_combo(8)
4:13.580 rising_sun_kick Fluffy_Pillow 68.0/110: 62% energy | 3.0/5: 60% chi hit_combo(8)
4:14.586 tiger_palm Fluffy_Pillow 79.6/110: 72% energy | 1.0/5: 20% chi hit_combo(8)
4:15.591 blackout_kick Fluffy_Pillow 41.2/110: 37% energy | 3.0/5: 60% chi hit_combo(8)
4:16.595 tiger_palm Fluffy_Pillow 52.8/110: 48% energy | 2.0/5: 40% chi hit_combo(8)
4:17.600 blackout_kick Fluffy_Pillow 14.4/110: 13% energy | 4.0/5: 80% chi hit_combo(8)
4:18.605 Waiting 1.500 sec 26.0/110: 24% energy | 3.0/5: 60% chi hit_combo(8)
4:20.105 fists_of_fury Fluffy_Pillow 43.4/110: 39% energy | 3.0/5: 60% chi hit_combo(8)
4:23.942 tiger_palm Fluffy_Pillow 87.7/110: 80% energy | 0.0/5: 0% chi hit_combo(8)
4:24.947 rising_sun_kick Fluffy_Pillow 49.3/110: 45% energy | 2.0/5: 40% chi hit_combo(8)
4:25.953 tiger_palm Fluffy_Pillow 60.9/110: 55% energy | 0.0/5: 0% chi hit_combo(8)
4:26.958 blackout_kick Fluffy_Pillow 22.5/110: 20% energy | 2.0/5: 40% chi hit_combo(8)
4:27.963 whirling_dragon_punch Fluffy_Pillow 34.1/110: 31% energy | 1.0/5: 20% chi hit_combo(8)
4:29.655 tiger_palm Fluffy_Pillow 53.7/110: 49% energy | 1.0/5: 20% chi hit_combo(8)
4:30.661 blackout_kick Fluffy_Pillow 15.3/110: 14% energy | 3.0/5: 60% chi hit_combo(8)
4:31.665 Waiting 1.700 sec 26.9/110: 24% energy | 2.0/5: 40% chi hit_combo(8)
4:33.365 rising_sun_kick Fluffy_Pillow 46.5/110: 42% energy | 2.0/5: 40% chi hit_combo(8)
4:34.610 tiger_palm Fluffy_Pillow 60.9/110: 55% energy | 0.0/5: 0% chi hit_combo(8)
4:35.614 blackout_kick Fluffy_Pillow 22.5/110: 20% energy | 2.0/5: 40% chi hit_combo(8)
4:36.619 storm_earth_and_fire Fluffy_Pillow 34.1/110: 31% energy | 1.0/5: 20% chi hit_combo(8)
4:36.619 Waiting 1.400 sec 34.1/110: 31% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
4:38.019 tiger_palm Fluffy_Pillow 50.3/110: 46% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
4:39.022 blackout_kick Fluffy_Pillow 11.8/110: 11% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
4:40.026 Waiting 1.200 sec 23.4/110: 21% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:41.226 chi_burst Fluffy_Pillow 37.3/110: 34% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:42.439 rising_sun_kick Fluffy_Pillow 51.3/110: 47% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:43.443 tiger_palm Fluffy_Pillow 62.9/110: 57% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
4:44.448 blackout_kick Fluffy_Pillow 24.5/110: 22% energy | 2.0/5: 40% chi bok_proc, hit_combo(8), storm_earth_and_fire(2)
4:45.451 strike_of_the_windlord Fluffy_Pillow 36.1/110: 33% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:46.955 tiger_palm Fluffy_Pillow 53.5/110: 49% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
4:47.960 blackout_kick Fluffy_Pillow 15.1/110: 14% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
4:48.964 Waiting 2.100 sec 26.7/110: 24% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
4:51.064 tiger_palm Fluffy_Pillow 50.9/110: 46% energy | 1.0/5: 20% chi hit_combo(8), storm_earth_and_fire(2)
4:52.067 fists_of_fury Fluffy_Pillow 12.5/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
4:55.771 tiger_palm Fluffy_Pillow 55.3/110: 50% energy | 0.0/5: 0% chi hit_combo(8)
4:56.777 rising_sun_kick Fluffy_Pillow 16.9/110: 15% energy | 2.0/5: 40% chi hit_combo(8)
4:57.781 whirling_dragon_punch Fluffy_Pillow 28.5/110: 26% energy | 0.0/5: 0% chi hit_combo(8)
4:59.590 Waiting 0.100 sec 49.4/110: 45% energy | 0.0/5: 0% chi hit_combo(8)
4:59.690 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 0.0/5: 0% chi hit_combo(8)
5:00.693 blackout_kick Fluffy_Pillow 12.1/110: 11% energy | 2.0/5: 40% chi hit_combo(8)
5:01.698 Waiting 2.300 sec 23.7/110: 22% energy | 1.0/5: 20% chi hit_combo(8)
5:03.998 energizing_elixir Fluffy_Pillow 50.3/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
5:04.176 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
5:05.181 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 5.0/5: 100% chi hit_combo(8)
5:06.185 rising_sun_kick Fluffy_Pillow 83.2/110: 76% energy | 4.0/5: 80% chi hit_combo(8)
5:07.191 blackout_kick Fluffy_Pillow 94.8/110: 86% energy | 2.0/5: 40% chi hit_combo(8)
5:08.195 tiger_palm Fluffy_Pillow 106.4/110: 97% energy | 1.0/5: 20% chi hit_combo(8)
5:09.199 blackout_kick Fluffy_Pillow 68.0/110: 62% energy | 3.0/5: 60% chi hit_combo(8)
5:10.203 tiger_palm Fluffy_Pillow 79.6/110: 72% energy | 2.0/5: 40% chi hit_combo(8)
5:11.208 blackout_kick Fluffy_Pillow 41.2/110: 37% energy | 4.0/5: 80% chi hit_combo(8)
5:12.213 chi_burst Fluffy_Pillow 52.8/110: 48% energy | 3.0/5: 60% chi hit_combo(8)
5:13.302 fists_of_fury Fluffy_Pillow 65.4/110: 59% energy | 3.0/5: 60% chi hit_combo(8)
5:17.040 tiger_palm Fluffy_Pillow 108.6/110: 99% energy | 0.0/5: 0% chi hit_combo(8)
5:18.044 rising_sun_kick Fluffy_Pillow 70.2/110: 64% energy | 2.0/5: 40% chi hit_combo(8)
5:19.049 whirling_dragon_punch Fluffy_Pillow 81.8/110: 74% energy | 0.0/5: 0% chi hit_combo(8)
5:20.779 tiger_palm Fluffy_Pillow 101.8/110: 93% energy | 0.0/5: 0% chi hit_combo(8)
5:21.782 blackout_kick Fluffy_Pillow 63.3/110: 58% energy | 2.0/5: 40% chi hit_combo(8)
5:22.786 tiger_palm Fluffy_Pillow 74.9/110: 68% energy | 1.0/5: 20% chi hit_combo(8)
5:23.790 blackout_kick Fluffy_Pillow 36.5/110: 33% energy | 3.0/5: 60% chi hit_combo(8)
5:24.794 Waiting 0.200 sec 48.1/110: 44% energy | 2.0/5: 40% chi hit_combo(8)
5:24.994 tiger_palm Fluffy_Pillow 50.4/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
5:25.998 strike_of_the_windlord Fluffy_Pillow 12.0/110: 11% energy | 4.0/5: 80% chi bok_proc, hit_combo(8)
5:27.502 rising_sun_kick Fluffy_Pillow 29.4/110: 27% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
5:28.509 blackout_kick Fluffy_Pillow 41.0/110: 37% energy | 0.0/5: 0% chi bok_proc, hit_combo(8)
5:29.514 tiger_palm Fluffy_Pillow 52.6/110: 48% energy | 0.0/5: 0% chi hit_combo(8)
5:30.519 blackout_kick Fluffy_Pillow 14.2/110: 13% energy | 2.0/5: 40% chi hit_combo(8)
5:31.524 Waiting 2.100 sec 25.8/110: 23% energy | 1.0/5: 20% chi hit_combo(8)
5:33.624 tiger_palm Fluffy_Pillow 50.1/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
5:34.628 fists_of_fury Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
5:38.435 tiger_palm Fluffy_Pillow 55.7/110: 51% energy | 0.0/5: 0% chi hit_combo(8)
5:39.438 rising_sun_kick Fluffy_Pillow 17.2/110: 16% energy | 2.0/5: 40% chi hit_combo(8)
5:40.441 whirling_dragon_punch Fluffy_Pillow 28.8/110: 26% energy | 0.0/5: 0% chi hit_combo(8)
5:42.123 Waiting 0.200 sec 48.3/110: 44% energy | 0.0/5: 0% chi hit_combo(8)
5:42.323 tiger_palm Fluffy_Pillow 50.6/110: 46% energy | 0.0/5: 0% chi hit_combo(8)
5:43.329 blackout_kick Fluffy_Pillow 12.2/110: 11% energy | 2.0/5: 40% chi hit_combo(8)
5:44.334 chi_burst Fluffy_Pillow 23.8/110: 22% energy | 1.0/5: 20% chi hit_combo(8)
5:45.340 Waiting 1.300 sec 35.4/110: 32% energy | 1.0/5: 20% chi hit_combo(8)
5:46.640 tiger_palm Fluffy_Pillow 50.4/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
5:47.645 blackout_kick Fluffy_Pillow 12.0/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
5:48.649 rising_sun_kick Fluffy_Pillow 23.6/110: 21% energy | 2.0/5: 40% chi hit_combo(8)
5:49.654 Waiting 1.300 sec 35.2/110: 32% energy | 0.0/5: 0% chi hit_combo(8)
5:50.954 tiger_palm Fluffy_Pillow 50.2/110: 46% energy | 0.0/5: 0% chi hit_combo(8)
5:51.959 blackout_kick Fluffy_Pillow 11.9/110: 11% energy | 2.0/5: 40% chi hit_combo(8)
5:52.964 Waiting 2.300 sec 23.5/110: 21% energy | 1.0/5: 20% chi hit_combo(8)
5:55.264 tiger_palm Fluffy_Pillow 50.0/110: 45% energy | 1.0/5: 20% chi hit_combo(8)
5:56.267 fists_of_fury Fluffy_Pillow 11.6/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
5:59.917 tiger_palm Fluffy_Pillow 53.8/110: 49% energy | 0.0/5: 0% chi hit_combo(8)
6:00.922 rising_sun_kick Fluffy_Pillow 15.4/110: 14% energy | 2.0/5: 40% chi hit_combo(8)
6:01.928 whirling_dragon_punch Fluffy_Pillow 27.0/110: 25% energy | 0.0/5: 0% chi hit_combo(8)
6:03.696 touch_of_death Fluffy_Pillow 47.4/110: 43% energy | 0.0/5: 0% chi hit_combo(8)
6:04.701 energizing_elixir Fluffy_Pillow 59.0/110: 54% energy | 0.0/5: 0% chi hit_combo(8)
6:04.701 blackout_kick Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
6:05.704 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 4.0/5: 80% chi hit_combo(8)
6:06.709 strike_of_the_windlord Fluffy_Pillow 71.6/110: 65% energy | 5.0/5: 100% chi hit_combo(8)
6:08.214 blackout_kick Fluffy_Pillow 89.0/110: 81% energy | 3.0/5: 60% chi hit_combo(8)
6:09.218 tiger_palm Fluffy_Pillow 100.6/110: 91% energy | 2.0/5: 40% chi hit_combo(8)
6:10.221 rising_sun_kick Fluffy_Pillow 62.2/110: 57% energy | 4.0/5: 80% chi bok_proc, hit_combo(8)
6:11.225 blackout_kick Fluffy_Pillow 73.8/110: 67% energy | 2.0/5: 40% chi bok_proc, hit_combo(8)
6:12.230 tiger_palm Fluffy_Pillow 85.4/110: 78% energy | 2.0/5: 40% chi hit_combo(8)
6:13.234 blackout_kick Fluffy_Pillow 47.0/110: 43% energy | 4.0/5: 80% chi hit_combo(8)
6:14.239 tiger_palm Fluffy_Pillow 58.6/110: 53% energy | 3.0/5: 60% chi hit_combo(8)
6:15.244 blackout_kick Fluffy_Pillow 20.2/110: 18% energy | 5.0/5: 100% chi hit_combo(8)
6:16.249 chi_burst Fluffy_Pillow 31.8/110: 29% energy | 4.0/5: 80% chi hit_combo(8)
6:17.255 fists_of_fury Fluffy_Pillow 43.4/110: 39% energy | 4.0/5: 80% chi hit_combo(8)
6:20.921 tiger_palm Fluffy_Pillow 85.7/110: 78% energy | 1.0/5: 20% chi hit_combo(8)
6:21.926 rising_sun_kick Fluffy_Pillow 47.4/110: 43% energy | 3.0/5: 60% chi hit_combo(8)
6:22.930 whirling_dragon_punch Fluffy_Pillow 58.9/110: 54% energy | 1.0/5: 20% chi hit_combo(8)
6:24.657 tiger_palm Fluffy_Pillow 78.9/110: 72% energy | 1.0/5: 20% chi hit_combo(8)
6:25.661 blackout_kick Fluffy_Pillow 40.5/110: 37% energy | 3.0/5: 60% chi hit_combo(8)
6:26.666 tiger_palm Fluffy_Pillow 52.1/110: 47% energy | 2.0/5: 40% chi hit_combo(8)
6:27.670 blackout_kick Fluffy_Pillow 13.7/110: 12% energy | 4.0/5: 80% chi hit_combo(8)
6:28.674 Waiting 1.700 sec 25.3/110: 23% energy | 3.0/5: 60% chi hit_combo(8)
6:30.374 rising_sun_kick Fluffy_Pillow 44.9/110: 41% energy | 3.0/5: 60% chi hit_combo(8)
6:31.589 tiger_palm Fluffy_Pillow 59.0/110: 54% energy | 1.0/5: 20% chi hit_combo(8)
6:32.593 blackout_kick Fluffy_Pillow 20.5/110: 19% energy | 3.0/5: 60% chi hit_combo(8)
6:33.597 storm_earth_and_fire Fluffy_Pillow 32.1/110: 29% energy | 2.0/5: 40% chi hit_combo(8)
6:33.597 Waiting 1.600 sec 32.1/110: 29% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:35.197 tiger_palm Fluffy_Pillow 50.6/110: 46% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:36.200 blackout_kick Fluffy_Pillow 12.2/110: 11% energy | 4.0/5: 80% chi hit_combo(8), storm_earth_and_fire(2)
6:37.204 Waiting 0.600 sec 23.8/110: 22% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
6:37.804 fists_of_fury Fluffy_Pillow 30.7/110: 28% energy | 3.0/5: 60% chi hit_combo(8), storm_earth_and_fire(2)
6:41.859 tiger_palm Fluffy_Pillow 77.6/110: 71% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:42.862 rising_sun_kick Fluffy_Pillow 39.1/110: 36% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:43.865 whirling_dragon_punch Fluffy_Pillow 50.7/110: 46% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:45.500 tiger_palm Fluffy_Pillow 69.6/110: 63% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:46.505 strike_of_the_windlord Fluffy_Pillow 31.2/110: 28% energy | 2.0/5: 40% chi hit_combo(8), storm_earth_and_fire(2)
6:48.212 chi_burst Fluffy_Pillow 50.9/110: 46% energy | 0.0/5: 0% chi hit_combo(8), storm_earth_and_fire(2)
6:49.215 tiger_palm Fluffy_Pillow 62.5/110: 57% energy | 0.0/5: 0% chi hit_combo(8)
6:50.218 blackout_kick Fluffy_Pillow 24.1/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
6:51.224 Waiting 1.300 sec 35.7/110: 32% energy | 1.0/5: 20% chi hit_combo(8)
6:52.524 tiger_palm Fluffy_Pillow 50.7/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
6:53.530 rising_sun_kick Fluffy_Pillow 12.4/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
6:54.537 Waiting 2.300 sec 24.0/110: 22% energy | 1.0/5: 20% chi hit_combo(8)
6:56.837 tiger_palm Fluffy_Pillow 50.5/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
6:57.843 blackout_kick Fluffy_Pillow 12.2/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
6:58.847 Waiting 2.300 sec 23.8/110: 22% energy | 2.0/5: 40% chi hit_combo(8)
7:01.147 tiger_palm Fluffy_Pillow 50.3/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
7:02.152 fists_of_fury Fluffy_Pillow 11.9/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
7:05.932 energizing_elixir Fluffy_Pillow 55.6/110: 51% energy | 1.0/5: 20% chi hit_combo(8)
7:05.932 rising_sun_kick Fluffy_Pillow 110.0/110: 100% energy | 5.0/5: 100% chi hit_combo(8)
7:06.936 whirling_dragon_punch Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi hit_combo(8)
7:08.737 blackout_kick Fluffy_Pillow 110.0/110: 100% energy | 3.0/5: 60% chi hit_combo(8)
7:09.740 tiger_palm Fluffy_Pillow 110.0/110: 100% energy | 2.0/5: 40% chi hit_combo(8)
7:10.744 blackout_kick Fluffy_Pillow 71.6/110: 65% energy | 4.0/5: 80% chi hit_combo(8)
7:11.747 tiger_palm Fluffy_Pillow 83.2/110: 76% energy | 3.0/5: 60% chi hit_combo(8)
7:12.752 blackout_kick Fluffy_Pillow 44.8/110: 41% energy | 5.0/5: 100% chi bok_proc, hit_combo(8)
7:13.756 tiger_palm Fluffy_Pillow 56.4/110: 51% energy | 5.0/5: 100% chi hit_combo(8)
7:14.760 rising_sun_kick Fluffy_Pillow 18.0/110: 16% energy | 5.0/5: 100% chi hit_combo(8)
7:15.765 blackout_kick Fluffy_Pillow 29.6/110: 27% energy | 3.0/5: 60% chi hit_combo(8)
7:16.771 Waiting 0.800 sec 41.2/110: 37% energy | 2.0/5: 40% chi hit_combo(8)
7:17.571 tiger_palm Fluffy_Pillow 50.4/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
7:18.576 blackout_kick Fluffy_Pillow 12.0/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
7:19.582 chi_burst Fluffy_Pillow 23.7/110: 22% energy | 3.0/5: 60% chi hit_combo(8)
7:20.586 blackout_kick Fluffy_Pillow 35.3/110: 32% energy | 3.0/5: 60% chi hit_combo(8)
7:21.591 Waiting 0.300 sec 46.9/110: 43% energy | 2.0/5: 40% chi hit_combo(8)
7:21.891 tiger_palm Fluffy_Pillow 50.3/110: 46% energy | 2.0/5: 40% chi hit_combo(8)
7:22.895 fists_of_fury Fluffy_Pillow 11.9/110: 11% energy | 4.0/5: 80% chi hit_combo(8)
7:26.616 tiger_palm Fluffy_Pillow 54.9/110: 50% energy | 1.0/5: 20% chi hit_combo(8)
7:27.622 strike_of_the_windlord Fluffy_Pillow 16.5/110: 15% energy | 3.0/5: 60% chi hit_combo(8)
7:29.128 Waiting 1.400 sec 33.9/110: 31% energy | 1.0/5: 20% chi hit_combo(8)
7:30.528 tiger_palm Fluffy_Pillow 50.1/110: 46% energy | 1.0/5: 20% chi hit_combo(8)
7:31.533 rising_sun_kick Fluffy_Pillow 11.7/110: 11% energy | 3.0/5: 60% chi hit_combo(8)
7:32.537 whirling_dragon_punch Fluffy_Pillow 23.3/110: 21% energy | 1.0/5: 20% chi hit_combo(8)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4727 4402 0
Agility 24453 22746 12636 (9448)
Stamina 29180 29180 19281
Intellect 7652 7327 0
Spirit 2 2 0
Health 1750800 1750800 0
Energy 110 110 0
Chi 5 5 0
Crit 28.23% 28.23% 4631
Haste 15.49% 15.49% 5035
Damage / Heal Versatility 6.10% 6.10% 2439
ManaReg per Second 8800 8800 0
Attack Power 24453 22746 0
Mastery 30.96% 30.96% 5868
Armor 2027 2027 2027
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Steelgazer Hide Hood
ilevel: 850, stats: { 267 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Vers }, gems: { +150 Vers }
Local Neck Erratically Ticking Talisman
ilevel: 840, stats: { +997 Sta, +960 Mastery, +808 Crit }
Local Shoulders Brinewashed Leather Shoulderpads
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +552 Mastery, +391 Vers, +404 Avoidance }
Local Shirt White Tuxedo Shirt
ilevel: 1
Local Chest Brinewashed Leather Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +899 Mastery, +359 Vers }
Local Waist Ovyd's Winter Wrap
ilevel: 895, stats: { 215 Armor, +2219 Sta, +1479 AgiInt, +496 Haste, +662 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery, +559 Avoidance }
Local Feet Bleak Underworld Treads
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +678 Haste, +301 Crit }
Local Wrists Compact Trifold Wristbands
ilevel: 845, stats: { 142 Armor, +696 AgiInt, +1045 Sta, +468 Vers, +252 Haste }
Local Hands Shadow Stalker Gloves
ilevel: 850, stats: { 206 Armor, +973 AgiInt, +1459 Sta, +699 Vers, +279 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 875, stats: { +1381 Sta, +1094 Haste, +921 Mastery }
Local Finger2 Seal of Saltheril
ilevel: 850, stats: { +1094 Sta, +1154 Haste, +682 Mastery }
Local Trinket1 Rocksunder Lucky Statue
ilevel: 835, stats: { +1073 Agi, +882 Crit }
Local Trinket2 An'she's Token of Guile
ilevel: 830, stats: { +1023 Agi, +865 Crit }
Local Back Rugged Marauder Cape
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Haste, +278 Mastery }
Local Main Hand Fists of the Heavens
ilevel: 848, weapon: { 3234 - 6008, 2.6 }, stats: { +546 Agi, +819 Sta, +282 Crit, +271 Mastery }, relics: { +22 ilevels, +37 ilevels, +39 ilevels }
Local Off Hand Fists of the Heavens
ilevel: 848, weapon: { 3234 - 6008, 2.6 }, stats: { +546 Agi, +819 Sta, +282 Crit, +271 Mastery }

Talents

Level
15 Chi Burst Eye of the Tiger Chi Wave
30 Chi Torpedo Tiger's Lust Celerity
45 Energizing Elixir (Windwalker Monk) Ascension (Windwalker Monk) Power Strikes (Windwalker Monk)
60 Ring of Peace Dizzying Kicks (Windwalker Monk) Leg Sweep
75 Healing Elixir Diffuse Magic Dampen Harm
90 Rushing Jade Wind Invoke Xuen, the White Tiger (Windwalker Monk) Hit Combo (Windwalker Monk)
100 Chi Orbit (Windwalker Monk) Whirling Dragon Punch (Windwalker Monk) Serenity (Windwalker Monk)

Profile

monk="Müjnir"
origin="https://eu.api.battle.net/wow/character/hyjal/Müjnir/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/61/114238781-avatar.jpg"
level=110
race=pandaren_alliance
role=dps
position=back
professions=inscription=737/herbalism=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#fb!0102121
artifact=50:0:0:0:0:820:1:824:3:826:1:829:3:831:1:832:1:1094:3:1341:1
spec=windwalker

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/potion,name=old_war,if=buff.serenity.up|buff.storm_earth_and_fire.up|(!talent.serenity.enabled&trinket.proc.agility.react)|buff.bloodlust.react|target.time_to_die<=60
actions+=/call_action_list,name=serenity,if=talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.rising_sun_kick.remains<=4)|buff.serenity.up)
actions+=/call_action_list,name=sef,if=!talent.serenity.enabled&((artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<=14&cooldown.fists_of_fury.remains<=6&cooldown.rising_sun_kick.remains<=6)|buff.storm_earth_and_fire.up)
actions+=/call_action_list,name=serenity,if=(!artifact.strike_of_the_windlord.enabled&cooldown.strike_of_the_windlord.remains<14&cooldown.fists_of_fury.remains<=15&cooldown.rising_sun_kick.remains<7)|buff.serenity.up
actions+=/call_action_list,name=sef,if=!talent.serenity.enabled&((!artifact.strike_of_the_windlord.enabled&cooldown.fists_of_fury.remains<=9&cooldown.rising_sun_kick.remains<=5)|buff.storm_earth_and_fire.up)
actions+=/call_action_list,name=st

actions.cd=invoke_xuen
actions.cd+=/blood_fury
actions.cd+=/berserking
actions.cd+=/touch_of_death,cycle_targets=1,max_cycle_targets=2,if=!artifact.gale_burst.enabled&equipped.137057&!prev_gcd.touch_of_death
actions.cd+=/touch_of_death,if=!artifact.gale_burst.enabled&!equipped.137057
actions.cd+=/touch_of_death,cycle_targets=1,max_cycle_targets=2,if=artifact.gale_burst.enabled&equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7&!prev_gcd.touch_of_death
actions.cd+=/touch_of_death,if=artifact.gale_burst.enabled&!equipped.137057&cooldown.strike_of_the_windlord.remains<8&cooldown.fists_of_fury.remains<=4&cooldown.rising_sun_kick.remains<7

actions.sef=energizing_elixir
actions.sef+=/arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
actions.sef+=/call_action_list,name=cd
actions.sef+=/storm_earth_and_fire
actions.sef+=/call_action_list,name=st

actions.serenity=energizing_elixir
actions.serenity+=/call_action_list,name=cd
actions.serenity+=/serenity
actions.serenity+=/strike_of_the_windlord
actions.serenity+=/rising_sun_kick,cycle_targets=1,if=active_enemies<3
actions.serenity+=/fists_of_fury
actions.serenity+=/spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
actions.serenity+=/rising_sun_kick,cycle_targets=1,if=active_enemies>=3
actions.serenity+=/blackout_kick,cycle_targets=1,if=!prev_gcd.blackout_kick
actions.serenity+=/spinning_crane_kick,if=!prev_gcd.spinning_crane_kick
actions.serenity+=/rushing_jade_wind,if=!prev_gcd.rushing_jade_wind

actions.st=call_action_list,name=cd
actions.st+=/arcane_torrent,if=chi.max-chi>=1&energy.time_to_max>=0.5
actions.st+=/energizing_elixir,if=energy<energy.max&chi<=1
actions.st+=/strike_of_the_windlord,if=talent.serenity.enabled|active_enemies<6
actions.st+=/fists_of_fury
actions.st+=/rising_sun_kick,cycle_targets=1
actions.st+=/whirling_dragon_punch
actions.st+=/spinning_crane_kick,if=active_enemies>=3&!prev_gcd.spinning_crane_kick
actions.st+=/rushing_jade_wind,if=chi.max-chi>1&!prev_gcd.rushing_jade_wind
actions.st+=/blackout_kick,cycle_targets=1,if=(chi>1|buff.bok_proc.up)&!prev_gcd.blackout_kick
actions.st+=/chi_wave,if=energy.time_to_max>=2.25
actions.st+=/chi_burst,if=energy.time_to_max>=2.25
actions.st+=/tiger_palm,cycle_targets=1,if=!prev_gcd.tiger_palm
actions.st+=/crackling_jade_lightning,interrupt=1,if=talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1&cooldown.rushing_jade_wind.remains>1
actions.st+=/crackling_jade_lightning,interrupt=1,if=!talent.rushing_jade_wind.enabled&chi.max-chi=1&prev_gcd.blackout_kick&cooldown.rising_sun_kick.remains>1&cooldown.fists_of_fury.remains>1&cooldown.strike_of_the_windlord.remains>1

head=steelgazer_hide_hood,id=134152,bonus_id=1726/1808/1512/3337,gems=150vers
neck=erratically_ticking_talisman,id=137418,bonus_id=1727/1492/1813
shoulders=brinewashed_leather_shoulderpads,id=134242,bonus_id=3397/40/1502/3336
back=rugged_marauder_cape,id=134407,bonus_id=1726/1492/3337
chest=brinewashed_leather_vest,id=134241,bonus_id=3432/1502/3336
shirt=white_tuxedo_shirt,id=6833
wrists=compact_trifold_wristbands,id=137442,bonus_id=1727/1497/3336
hands=shadow_stalker_gloves,id=136741,bonus_id=1727/1512/3336
waist=ovyds_winter_wrap,id=138879,bonus_id=1811
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/40/1472
feet=bleak_underworld_treads,id=137324,bonus_id=1727/1502/3336
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1497/3337
finger2=seal_of_saltheril,id=137532,bonus_id=1727/1502/3336
trinket1=rocksunder_lucky_statue,id=134159,bonus_id=3432/603/1497/1674
trinket2=anshes_token_of_guile,id=139113,bonus_id=3397/603/1492/1675
main_hand=fists_of_the_heavens,id=128940,bonus_id=734,gem_id=133124/141268/141258/0,relic_id=1792:1591:1809/3397:1492:1675/3432:1497:1674/0
off_hand=fists_of_the_heavens,id=133948

# Gear Summary
# gear_ilvl=849.13
# gear_agility=12636
# gear_stamina=19281
# gear_crit_rating=4631
# gear_haste_rating=5035
# gear_mastery_rating=5868
# gear_versatility_rating=2439
# gear_avoidance_rating=963
# gear_armor=2027

Squallz

Squallz : 225676 dps

  • Race: Human
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
225675.7 225675.7 126.6 / 0.056% 25376.8 / 11.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 2.75% 50.1 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Squallz/advanced
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Repentance
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Cavalier (Retribution Paladin)
  • 100: Divine Purpose (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 775
  • blacksmithing: 755

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Squallz 225676
Blade of Wrath 24040 10.7% 68.2 6.62sec 158819 127651 Direct 68.2 71110 142270 84309 18.5%  
Periodic 200.9 21335 42671 25279 18.5% 89.0%

Stats details: blade_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.17 68.17 200.94 200.94 1.2442 1.9959 10827081.73 10827081.73 0.00 22283.54 127650.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.53 81.45% 71109.66 66020 89127 71117.67 68275 73887 3948672 3948672 0.00
crit 12.64 18.55% 142270.06 132041 178255 142275.01 132041 170552 1798763 1798763 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 163.8 81.51% 21334.62 737 26883 21335.77 20745 21855 3494593 3494593 0.00
crit 37.1 18.49% 42671.47 3186 53767 42671.17 39038 47055 1585053 1585053 0.00
 
 

Action details: blade_of_wrath

Static Values
  • id:202270
  • school:holy
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:202270
  • name:Blade of Wrath
  • school:holy
  • tooltip:Deals {$s4=0} Holy damage every $t4 sec.
  • description:Strikes an enemy with the Blade of Wrath, dealing $sw2 Holy damage, and an additional $o4 Holy damage over {$d=6 seconds}. |cFFFFFFFFGenerates {$s3=2} Holy Power.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.550000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.36
 
Greater Blessing of Might (blessing_of_might_proc) 16997 7.5% 206.8 2.65sec 37014 0 Direct 177.2 43195 0 43195 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 206.78 177.18 0.00 0.00 0.0000 0.0000 7653502.57 7653502.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.18 100.00% 43195.35 7985 846385 43207.22 31428 59586 7653503 7653503 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19806.08
  • base_dd_max:19806.08
 
Templar's Verdict (echoed_verdict) 6925 3.1% 84.5 5.29sec 36889 0 Direct 84.5 31110 62203 36889 18.6%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.54 84.54 0.00 0.00 0.0000 0.0000 3118789.29 3118789.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.83 81.41% 31109.63 28899 39014 31113.08 30055 32271 2141258 2141258 0.00
crit 15.72 18.59% 62202.71 57799 78028 62210.77 57799 73533 977532 977532 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Judgment 16923 7.5% 44.0 10.29sec 173229 139131 Direct 44.0 146249 292377 173264 18.5%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.99 43.98 0.00 0.00 1.2451 0.0000 7619770.54 7619770.54 0.00 139130.69 139130.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.85 81.51% 146248.53 135536 182974 146271.53 138501 153782 5242834 5242834 0.00
crit 8.13 18.49% 292377.46 271073 365948 292341.79 0 365948 2376937 2376937 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to {$s3=3} other nearby enemies]?s137027[ and {$s2=1} other nearby enemy][], dealing {$s1=1} Holy damage{$?s76672=false}[, and causing them to take $197277s2% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s137029[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?s137028[, and reducing the remaining cooldown on Shield of the Righteous by {$s2=1} sec, or ${$m2*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Justicar's Vengeance 18941 8.4% 20.5 20.71sec 416249 333401 Direct 20.5 350814 702613 416252 18.6%  

Stats details: justicars_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.49 20.49 0.00 0.00 1.2485 0.0000 8530386.85 8530386.85 0.00 333400.56 333400.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.68 81.40% 350813.74 326571 440871 350824.98 326571 404777 5852223 5852223 0.00
crit 3.81 18.60% 702612.71 653143 881743 684535.66 0 881743 2678164 2678164 0.00
 
 

Action details: justicars_vengeance

Static Values
  • id:215661
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:5.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
Spelldata
  • id:215661
  • name:Justicar's Vengeance
  • school:holy
  • tooltip:
  • description:A weapon strike that deals {$s1=0} Holy damage and restores health equal to the damage done. Deals {$s2=100}% additional damage and healing when used against a stunned target.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 11370 5.0% 150.8 2.98sec 33961 11402 Direct 150.8 28647 57303 33961 18.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.77 150.77 0.00 0.00 2.9784 0.0000 5120320.71 7527356.45 31.98 11402.31 11402.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.82 81.46% 28647.39 26615 35931 28651.20 27792 29446 3518417 5172407 31.98
crit 27.95 18.54% 57303.04 53231 71861 57314.00 53231 63710 1601903 2354950 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 8804 3.8% 21.5 6.91sec 181176 0 Direct 21.5 152895 305732 181180 18.5%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.54 21.54 0.00 0.00 0.0000 0.0000 3902202.05 5736606.64 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.55 81.50% 152894.90 115571 156021 152909.36 144463 156021 2683755 3945374 31.98
crit 3.99 18.50% 305731.65 231142 312041 301330.13 0 312041 1218447 1791233 31.50
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 9758 4.3% 5.5 89.66sec 794091 0 Direct 5.3 695906 1401040 825780 18.4%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.53 5.32 0.00 0.00 0.0000 0.0000 4391287.01 4391287.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.34 81.58% 695905.82 522460 1410642 695219.24 0 1410642 3018621 3018621 0.00
crit 0.98 18.42% 1401040.46 1044920 2821284 921796.17 0 2821284 1372666 1372666 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1044920.00
  • base_dd_max:1044920.00
 
Templar's Verdict 69257 30.7% 84.6 5.29sec 368787 296326 Direct 84.6 311082 622188 368787 18.5%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.57 84.57 0.00 0.00 1.2445 0.0000 31187716.58 31187716.58 0.00 296325.98 296325.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.88 81.45% 311081.77 288993 390140 311115.72 300027 322708 21428147 21428147 0.00
crit 15.69 18.55% 622187.87 577985 780280 622242.19 577985 722481 9759569 9759569 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $224266sw1 Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 6972 3.1% 14.4 32.47sec 218144 173403 Direct 14.4 184153 368147 218152 18.5%  

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 0.00 0.00 1.2581 0.0000 3139468.43 3139468.43 0.00 173403.39 173403.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.73 81.53% 184153.36 169801 229231 184179.77 169801 203761 2160693 2160693 0.00
crit 2.66 18.47% 368146.96 339601 458461 347155.50 0 458461 978775 978775 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Zeal 35689 15.8% 118.4 3.81sec 135669 109126 Direct 118.4 99378 198766 135671 36.5%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.44 118.44 0.00 0.00 1.2432 0.0000 16069104.48 23623105.69 31.98 109125.82 109125.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.19 63.49% 99378.20 92059 124280 99393.06 95574 103905 7472746 10985645 31.98
crit 43.25 36.51% 198765.71 184118 248560 198803.63 185959 216339 8596358 12637461 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Squallz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Squallz
  • harmful:false
  • if_expr:
 
Avenging Wrath 4.3 120.11sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by {$s1=35}%.
  • description:Increases all damage and healing you deal by {$s1=35}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Squallz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Squallz
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Squallz
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 14.4 32.08sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Shield of Vengeance 5.5 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 5.53 5.53 0.00 0.00 0.0000 0.0000 0.00 3426112.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.50 81.42% 0.00 0 0 0.00 0 0 0 2352246 100.00
crit 1.03 18.58% 0.00 0 0 0.00 0 0 0 1073867 67.58
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Squallz
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avenging Wrath 4.3 0.0 120.3sec 120.1sec 20.97% 21.55% 0.0(0.0) 4.1

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:22.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avenging_wrath_1:20.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by {$s1=35}%.
  • description:Increases all damage and healing you deal by {$s1=35}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:21.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.44% 0.0(0.0) 1.0

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Divine Purpose 21.0 0.0 20.3sec 20.3sec 12.95% 12.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • divine_purpose_1:12.95%

Trigger Attempt Success

  • trigger_pct:19.87%

Spelldata details

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power consuming ability will cost no Holy Power.
  • description:{$@spelldesc223817=Your Holy Power spending abilities have a {$h=20}% chance to make your next Holy Power spending ability free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 120.6sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 5.5 0.0 90.0sec 90.0sec 18.10% 18.16% 0.0(0.0) 5.3

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.0 117.4 262.9sec 3.8sec 99.73% 99.14% 115.4(115.4) 0.0

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.67%
  • zeal_2:0.49%
  • zeal_3:98.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Squallz
templars_verdict Holy Power 84.6 252.5 3.0 3.0 123507.6
Resource Gains Type Count Total Average Overflow
zeal Holy Power 118.44 118.44 (46.49%) 1.00 0.00 0.00%
blade_of_wrath Holy Power 68.17 136.34 (53.51%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.57 0.56
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.31 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
divine_purpose 21.0 20.3sec

Statistics & Data Analysis

Fight Length
Sample Data Squallz Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Squallz Damage Per Second
Count 9999
Mean 225675.70
Minimum 202120.56
Maximum 252651.97
Spread ( max - min ) 50531.41
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 6459.3593
5th Percentile 215606.42
95th Percentile 236678.84
( 95th Percentile - 5th Percentile ) 21072.41
Mean Distribution
Standard Deviation 64.5968
95.00% Confidence Intervall ( 225549.09 - 225802.31 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3147
0.1 Scale Factor Error with Delta=300 356174
0.05 Scale Factor Error with Delta=300 1424697
0.01 Scale Factor Error with Delta=300 35617427
Priority Target DPS
Sample Data Squallz Priority Target Damage Per Second
Count 9999
Mean 225675.70
Minimum 202120.56
Maximum 252651.97
Spread ( max - min ) 50531.41
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 6459.3593
5th Percentile 215606.42
95th Percentile 236678.84
( 95th Percentile - 5th Percentile ) 21072.41
Mean Distribution
Standard Deviation 64.5968
95.00% Confidence Intervall ( 225549.09 - 225802.31 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3147
0.1 Scale Factor Error with Delta=300 356174
0.05 Scale Factor Error with Delta=300 1424697
0.01 Scale Factor Error with Delta=300 35617427
DPS(e)
Sample Data Squallz Damage Per Second (Effective)
Count 9999
Mean 225675.70
Minimum 202120.56
Maximum 252651.97
Spread ( max - min ) 50531.41
Range [ ( max - min ) / 2 * 100% ] 11.20%
Damage
Sample Data Squallz Damage
Count 9999
Mean 101559630.24
Minimum 73855128.03
Maximum 131853395.91
Spread ( max - min ) 57998267.87
Range [ ( max - min ) / 2 * 100% ] 28.55%
DTPS
Sample Data Squallz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Squallz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Squallz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Squallz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Squallz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Squallz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SquallzTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Squallz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_attack
7 14.39 rebuke
8 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
9 4.32 avenging_wrath
A 5.53 shield_of_vengeance
0.00 crusade,if=holy_power>=5
B 1.00 wake_of_ashes,if=holy_power>=0&time<2
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
C 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
D 0.00 call_action_list,name=BoW,if=talent.blade_of_wrath.enabled
E 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.BoW
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
F 1.95 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
G 20.23 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
H 1.70 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
I 15.97 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
J 13.39 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_wrath.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.67|cooldown.crusader_strike.charges_fractional<=0.67)
K 43.64 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4&!talent.the_fires_of_justice.enabled
L 68.17 blade_of_wrath,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 crusader_strike,if=charges=2&holy_power<=4&talent.the_fires_of_justice.enabled
M 43.99 judgment
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
N 16.85 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
O 48.38 templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
P 74.81 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4

Sample Sequence

0123569ABK7LMKOPLOPPMLGPOPLOMPPLOPMLIPPIJLMPOPLO7PPLMOPPLGPPMOLOKPJLMOKPLGPM7LGKNOKLMKOAPLIJKMLKGPOLPMONKLO7KPMLO98PPIJLMPOPLOPMLOKPLPMGNL7IKNPLMGKHIJKLMKONKLOKMAPLGPOPL7MONKLHIJKLMKOP7LOPPMLGNPOLPMOP7LIJKPLMOPPL9GPMLG7NKOLKMOKLIJK7PLMOPAPLGPMLGPONLKMO7KLIJKPLMOPPLGPMLGPOPLPMOPLIJPM7LOKPOLPMOPLOPPLMOPPIJLA9MPOPLONPMLO7KPLPMGPLGPIJLMKOPLOPPMLOPPL7MGPLGPIJLKMOKLOKNPLMNKGLKGPM7LAFG

Sample Sequence Table

time name target resources buffs
Pre flask Squallz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Squallz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Squallz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Squallz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 avenging_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, shield_of_vengeance, potion_of_the_old_war
0:01.213 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, shield_of_vengeance, potion_of_the_old_war
0:02.198 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal, shield_of_vengeance, potion_of_the_old_war
0:02.198 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal, shield_of_vengeance, potion_of_the_old_war
0:03.182 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal, shield_of_vengeance, potion_of_the_old_war
0:04.165 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal, shield_of_vengeance, potion_of_the_old_war
0:05.150 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, avenging_wrath, zeal(2), shield_of_vengeance, potion_of_the_old_war
0:06.135 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal(2), shield_of_vengeance, potion_of_the_old_war
0:07.118 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:08.102 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:09.085 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:10.070 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:11.054 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:12.039 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:13.023 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:14.009 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:14.992 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal(3), shield_of_vengeance, potion_of_the_old_war
0:15.975 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:16.961 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:17.945 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:18.929 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:19.913 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:20.897 Waiting 0.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:21.597 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, avenging_wrath, zeal(3), potion_of_the_old_war
0:22.790 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), potion_of_the_old_war
0:23.775 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3)
0:24.759 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3)
0:25.743 Waiting 0.800 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:26.543 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:27.753 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:28.738 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3)
0:29.722 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3)
0:30.706 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:31.692 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3)
0:32.677 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3)
0:33.663 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3)
0:34.650 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:35.635 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3)
0:36.620 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3)
0:37.605 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3)
0:38.589 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3)
0:39.573 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3)
0:40.557 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3)
0:40.557 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3)
0:41.541 Waiting 0.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
0:42.141 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
0:43.667 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
0:44.946 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
0:46.225 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
0:47.503 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
0:48.780 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
0:50.059 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
0:51.338 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
0:52.615 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
0:53.893 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
0:53.993 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
0:55.426 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
0:56.704 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
0:57.981 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
0:59.260 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:00.537 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:01.815 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:03.092 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:04.369 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:05.648 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
1:06.926 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
1:08.206 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:09.484 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:10.762 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:12.041 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
1:13.320 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:14.600 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:15.600 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:17.121 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:17.121 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:18.411 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
1:19.689 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
1:20.968 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
1:22.247 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:23.525 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:24.803 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:26.082 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:27.359 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:28.637 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
1:29.917 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:30.000 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance
1:31.279 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:32.558 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance
1:33.835 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance
1:35.113 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance
1:36.390 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:37.668 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:38.947 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance
1:40.227 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance
1:41.504 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
1:42.783 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
1:44.062 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
1:45.338 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:46.617 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:47.895 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:49.173 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), divine_purpose
1:50.452 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:51.731 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:53.010 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
1:54.289 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:54.289 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
1:55.569 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
1:56.845 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:58.124 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
1:59.401 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:00.679 avenging_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
2:00.679 potion Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3)
2:00.679 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:01.957 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:03.235 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:04.512 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:05.791 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:07.068 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:08.348 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:09.626 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:10.905 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:12.183 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:13.461 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:14.740 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:16.020 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:17.020 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:18.540 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:19.831 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:21.110 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:22.388 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), potion_of_the_old_war
2:23.665 Waiting 1.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), potion_of_the_old_war
2:24.765 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), potion_of_the_old_war
2:26.203 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:27.482 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:28.761 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:30.040 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
2:31.319 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:32.598 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:32.598 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:33.877 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), divine_purpose
2:35.155 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
2:36.433 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:37.711 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:38.990 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:40.269 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
2:41.546 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
2:42.824 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
2:44.102 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:45.382 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
2:46.661 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
2:47.939 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
2:49.217 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:50.494 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
2:51.771 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:53.049 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), divine_purpose
2:54.329 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
2:55.608 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
2:56.889 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
2:58.167 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
2:59.446 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:00.000 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
3:00.724 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
3:02.003 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
3:03.282 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance
3:04.560 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
3:05.839 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
3:07.116 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
3:08.395 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance
3:09.674 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
3:09.674 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
3:10.951 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
3:12.230 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), divine_purpose, shield_of_vengeance
3:13.507 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), divine_purpose, shield_of_vengeance
3:14.786 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), divine_purpose, shield_of_vengeance
3:16.065 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
3:17.344 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:18.623 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:19.903 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:21.180 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:22.458 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:23.736 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:25.017 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:26.296 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:27.576 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:27.576 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:28.856 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:30.135 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:31.413 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:32.692 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:33.972 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:35.251 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
3:36.530 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
3:37.808 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:39.087 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:40.364 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:41.644 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:42.922 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:44.200 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:45.478 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:46.758 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:46.758 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:48.037 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
3:49.316 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:50.594 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
3:51.872 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:53.151 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:54.431 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:55.710 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
3:56.990 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
3:58.269 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
3:59.548 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:00.826 avenging_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
4:00.826 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power avenging_wrath, zeal(3)
4:02.104 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3)
4:03.381 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:04.381 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:05.902 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:07.200 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power avenging_wrath, zeal(3)
4:08.480 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), divine_purpose
4:08.480 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), divine_purpose
4:09.758 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3)
4:11.037 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:12.317 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3)
4:13.594 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3)
4:14.872 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:16.150 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:17.428 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3)
4:18.707 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3)
4:19.984 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3)
4:21.264 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3)
4:22.542 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3)
4:23.820 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:23.820 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:25.098 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
4:26.376 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
4:27.654 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
4:28.932 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:30.000 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:30.210 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:31.489 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:32.768 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance
4:34.046 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:35.324 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:36.324 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:37.846 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:39.140 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance
4:40.418 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
4:41.698 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance
4:42.976 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), divine_purpose, shield_of_vengeance
4:44.255 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance
4:45.534 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
4:46.812 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:48.089 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:49.367 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:49.367 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:50.645 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:51.924 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
4:53.201 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:54.478 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
4:55.756 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
4:57.036 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
4:58.315 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
4:59.593 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:00.871 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:02.151 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:03.427 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:04.708 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
5:05.988 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:07.266 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:08.266 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:09.787 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:11.078 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
5:12.358 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:13.637 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:14.916 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
5:16.195 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:17.474 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:18.751 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:20.030 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:21.309 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:22.588 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:23.868 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:25.146 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:26.423 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:27.703 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:28.703 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:30.221 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:30.221 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:31.499 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:32.777 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:34.056 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:35.334 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:36.613 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
5:37.891 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:39.170 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:40.450 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:41.728 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
5:43.007 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:44.287 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:45.563 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
5:46.842 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:47.842 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:49.344 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:50.657 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:51.936 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
5:53.213 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
5:54.493 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:55.493 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
5:56.990 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
5:58.269 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
5:59.547 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
6:00.000 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
6:00.827 avenging_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance
6:00.827 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:02.128 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:03.408 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:04.686 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:05.964 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:07.244 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:08.521 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), divine_purpose, shield_of_vengeance
6:09.799 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:11.078 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:12.357 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:13.635 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:14.914 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:14.914 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power avenging_wrath, zeal(3), shield_of_vengeance
6:16.193 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power avenging_wrath, zeal(3)
6:17.472 Waiting 1.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3)
6:18.572 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power avenging_wrath, zeal(3)
6:20.008 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power avenging_wrath, zeal(3)
6:21.286 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power avenging_wrath, zeal(3)
6:22.564 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power avenging_wrath, zeal(3)
6:23.844 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:25.122 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:26.401 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:27.679 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:28.958 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:30.235 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
6:31.515 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
6:32.793 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:34.071 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:35.349 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:36.626 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
6:37.905 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
6:39.185 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:40.462 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
6:41.742 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
6:43.020 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:44.301 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:45.580 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
6:46.859 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
6:48.139 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:49.139 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:50.638 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:51.951 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:51.951 Waiting 1.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:53.051 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:54.491 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:55.769 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
6:57.048 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
6:58.327 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
6:59.607 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
7:00.885 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
7:02.163 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
7:03.442 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
7:04.722 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
7:06.000 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
7:07.277 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
7:08.556 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3)
7:09.833 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3)
7:11.113 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3)
7:12.390 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), divine_purpose
7:13.671 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), divine_purpose
7:14.949 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), divine_purpose
7:16.227 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
7:17.504 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), divine_purpose
7:18.783 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), divine_purpose
7:20.060 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
7:21.339 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
7:22.617 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3)
7:23.896 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3)
7:25.175 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3)
7:26.454 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), divine_purpose
7:27.733 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
7:29.012 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
7:29.012 blade_of_wrath Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), divine_purpose
7:30.000 shield_of_vengeance Squallz 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), divine_purpose, shield_of_vengeance
7:30.291 justicars_vengeance Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), divine_purpose, shield_of_vengeance
7:31.569 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26123 24417 13023 (9166)
Agility 3200 3200 0
Stamina 30451 30451 19547
Intellect 7328 7328 0
Spirit 0 0 0
Health 1827060 1827060 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 26123 24417 0
Crit 18.52% 18.52% 4733
Haste 17.72% 16.54% 5376
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 26123 24417 0
Mastery 48.82% 48.82% 8592
Armor 4037 4037 4037
Run Speed 7 0 0
Leech 3.71% 3.71% 853

Gear

Source Slot Average Item Level: 851.00
Local Head Nightsfall Helmet
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +869 Haste, +412 Mastery }, gems: { +150 Haste }
Local Neck Chain of the Green Flight
ilevel: 850, stats: { +1094 Sta, +1258 Mastery, +577 Crit }
Local Shoulders Skoldiir Shoulderguards
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Crit, +336 Mastery }
Local Chest Etheldrin's Breastplate
ilevel: 840, stats: { 668 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste, +539 Leech }
Local Waist Girdle of the Silver Hand
ilevel: 840, stats: { 376 Armor, +1329 Sta, +886 StrInt, +592 Mastery, +350 Haste }
Local Legs Legguards of Illusory Burdens
ilevel: 850, stats: { 597 Armor, +1945 Sta, +1297 StrInt, +876 Crit, +428 Haste }
Local Feet Trampling Warboots
ilevel: 850, stats: { 469 Armor, +1459 Sta, +973 StrInt, +553 Mastery, +426 Haste }
Local Wrists Uther's Guard
ilevel: 895, stats: { 330 Armor, +1665 Sta, +1110 StrInt, +496 Crit, +372 Mastery }
Local Hands Nightsfall Gauntlets
ilevel: 840, stats: { 417 Armor, +886 StrInt, +1329 Sta, +633 Haste, +310 Mastery }
Local Finger1 Nightborne Signet Ring
ilevel: 850, stats: { +1094 Sta, +314 Leech, +1206 Mastery, +629 Haste }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 860, stats: { +1201 Sta, +1362 Mastery, +545 Haste }
Local Trinket1 Ironrune Charm
ilevel: 835, stats: { +1073 Str, +882 Haste }
Local Trinket2 Resilient Heart of the Forest
ilevel: 845, stats: { +1177 Str, +915 Crit }, gems: { +150 Crit }
Local Back Putrid Carapace
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +429 Mastery, +278 Crit }
Local Main Hand Ashbringer
ilevel: 873, weapon: { 8315 - 12474, 3.6 }, stats: { +1607 Str, +2411 Sta, +723 Crit, +695 Mastery }, relics: { +40 ilevels, +40 ilevels, +43 ilevels }
Local Tabard Stormwind Tabard
ilevel: 1

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Squallz"
origin="https://eu.api.battle.net/wow/character/hyjal/Squallz/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/225/145487073-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=blacksmithing=755/mining=775
talents=http://eu.battle.net/wow/en/tool/talent-calculator#bb!0111010
artifact=2:0:0:0:0:40:1:42:3:43:3:47:3:50:3:52:3:54:1:351:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=BoW,if=talent.blade_of_wrath.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.BoW=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_wrath.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.67|cooldown.crusader_strike.charges_fractional<=0.67)
actions.BoW+=/zeal,if=charges=2&holy_power<=4
actions.BoW+=/crusader_strike,if=charges=2&holy_power<=4&!talent.the_fires_of_justice.enabled
actions.BoW+=/blade_of_wrath,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.BoW+=/crusader_strike,if=charges=2&holy_power<=4&talent.the_fires_of_justice.enabled
actions.BoW+=/judgment
actions.BoW+=/consecration
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.BoW+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.BoW+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.BoW+=/zeal,if=holy_power<=4
actions.BoW+=/crusader_strike,if=holy_power<=4

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=nightsfall_helmet,id=139058,bonus_id=1727/1808/1507/3336,gems=150haste
neck=chain_of_the_green_flight,id=137311,bonus_id=3410/1502/3336
shoulders=skoldiir_shoulderguards,id=134184,bonus_id=1727/1507/3336
back=putrid_carapace,id=134408,bonus_id=1727/1492/1813
chest=etheldrins_breastplate,id=136976,bonus_id=1727/41/1492/1813
tabard=stormwind_tabard,id=45574
wrists=uthers_guard,id=137105,bonus_id=1811
hands=nightsfall_gauntlets,id=139056,bonus_id=1727/1502/1813
waist=girdle_of_the_silver_hand,id=139696,bonus_id=3386/3384
legs=legguards_of_illusory_burdens,id=137528,bonus_id=1727/1502/3336
feet=trampling_warboots,id=139234,bonus_id=1807/1472
finger1=nightborne_signet_ring,id=134279,bonus_id=3397/41/1512/3337
finger2=archdruids_tainted_seal,id=134487,bonus_id=1727/1512/3337
trinket1=ironrune_charm,id=134190,bonus_id=3397/604/1497/3336
trinket2=resilient_heart_of_the_forest,id=139064,bonus_id=3397/1808/603/1507/3337,gems=150crit
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=137548/137316/137495/0,relic_id=1726:1492:3337/1727:1492:1813/1727:1502:3336/0

# Gear Summary
# gear_ilvl=850.53
# gear_strength=13023
# gear_stamina=19547
# gear_crit_rating=4640
# gear_haste_rating=5271
# gear_mastery_rating=8424
# gear_leech_rating=853
# gear_armor=4037

Waleràn

Waleràn : 212780 dps

  • Race: Dwarf
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
212780.4 212780.4 76.1 / 0.036% 15267.2 / 7.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.04% 39.4 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Psychic Voice
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • engineering: 702
  • inscription: 700

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Waleràn 212780
Deadly Grace 6886 3.2% 29.2 15.96sec 104539 0 Direct 29.2 86889 177265 104541 19.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.20 29.20 0.00 0.00 0.0000 0.0000 3052761.70 3052761.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.50 80.47% 86889.42 79173 95008 86879.58 81812 91565 2041590 2041590 0.00
crit 5.70 19.53% 177264.63 161513 193816 176805.87 0 193816 1011172 1011172 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 21880 10.3% 61.3 7.23sec 160638 157926 Direct 62.3 131541 268396 158060 19.4%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.35 62.35 0.00 0.00 1.0172 0.0000 9855043.50 9855043.50 0.00 157925.80 157925.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.27 80.62% 131540.88 108675 156492 131537.92 126695 136287 6612191 6612191 0.00
crit 12.08 19.38% 268396.49 221697 319244 268323.47 231550 311643 3242852 3242852 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage. |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 31247 14.7% 139.6 3.21sec 100844 59324 Periodic 441.7 26509 54077 31867 19.4% 49.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.59 0.00 441.73 441.73 1.6999 0.4998 14076644.43 14076644.43 0.00 59324.29 59324.29
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 355.9 80.56% 26509.27 22635 32661 26511.63 26093 26945 9433937 9433937 0.00
crit 85.9 19.44% 54076.50 46175 66628 54080.89 51544 57143 4642708 4642708 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.] |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.600000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 6896 3.2% 15.8 10.53sec 196301 191356 Direct 15.8 163204 333045 196296 19.5%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 0.00 0.00 1.0259 0.0000 3103797.76 3103797.76 0.00 191356.21 191356.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.73 80.51% 163204.25 116803 168196 163175.44 150027 168196 2077620 2077620 0.00
crit 3.08 19.49% 333044.69 238278 343121 320761.18 0 343121 1026178 1026178 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 35320 16.6% 3.0 114.47sec 5239745 5309183 Direct 3.0 28739 58678 34523 19.3%  
Periodic 332.7 39514 80575 47501 19.5% 99.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 3.04 332.65 332.65 0.9871 1.3464 15906311.39 15906311.39 0.00 35277.43 5309182.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.45 80.69% 28738.52 26961 48141 27631.51 0 46588 70389 70389 0.00
crit 0.59 19.31% 58678.07 55000 98208 26985.63 0 96624 34396 34396 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 267.9 80.55% 39513.82 23 70659 39521.80 38055 41018 10587556 10587556 0.00
crit 64.7 19.45% 80575.46 142 144144 80563.76 70973 90751 5213970 5213970 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.{$?s137033=false}[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 5502 2.6% 90.5 4.90sec 27373 0 Direct 89.6 23000 46920 27649 19.4%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.54 89.63 0.00 0.00 0.0000 0.0000 2478262.94 2478262.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.21 80.57% 23000.38 18900 27216 23000.40 21676 24459 1660965 1660965 0.00
crit 17.42 19.43% 46920.00 38556 55521 46925.38 40869 52436 817298 817298 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 40160 18.9% 1.0 135.21sec 17425976 18571078 Periodic 220.6 68165 139038 81985 19.5% 99.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.04 0.00 220.63 220.63 0.9391 2.0239 18088229.81 18088229.81 0.00 40420.17 18571077.84
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.6 80.50% 68165.34 1964 121553 68178.84 65353 71738 12106840 12106840 0.00
crit 43.0 19.50% 139037.71 26880 247969 139030.87 115904 164075 5981390 5981390 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.870000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 33198 15.6% 86.2 5.09sec 173509 166960 Direct 85.9 144707 295143 174072 19.5%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.17 85.89 0.00 0.00 1.0392 0.0000 14951442.24 14951442.24 0.00 166960.08 166960.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.13 80.48% 144706.73 111696 160842 144710.16 141394 147691 10003206 10003206 0.00
crit 16.77 19.52% 295142.59 227860 328118 295133.03 273432 321282 4948237 4948237 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage and refreshing Shadow Word: Pain and Vampiric Touch to their original duration. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 3449 1.6% 12.9 35.61sec 120834 0 Direct 25.6 50289 102614 60589 19.7%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.86 25.64 0.00 0.00 0.0000 0.0000 1553496.37 1553496.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.59 80.32% 50288.77 47251 56701 50286.19 47251 52651 1035611 1035611 0.00
crit 5.05 19.68% 102613.59 96392 115670 102148.26 0 115670 517885 517885 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 12784 6.0% 7.5 63.18sec 767213 181395 Periodic 54.5 87897 179239 105635 19.4% 6.6%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 0.00 54.46 54.46 4.2295 0.5478 5752751.88 5752751.88 0.00 181394.71 181394.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.9 80.58% 87896.78 691 108865 87880.51 79896 96410 3857120 3857120 0.00
crit 10.6 19.42% 179239.02 1411 222085 179172.43 0 222085 1895632 1895632 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.400000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - mindbender 59373 / 15457
melee 59373 7.3% 109.3 4.02sec 63613 61729 Direct 109.3 53283 106564 63612 19.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.35 109.35 0.00 0.00 1.0305 0.0000 6955770.60 6955770.60 0.00 61729.21 61729.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.15 80.61% 53283.00 47250 54337 53282.47 52797 53871 4696675 4696675 0.00
crit 21.20 19.39% 106563.70 94500 108675 106564.02 99563 108675 2259096 2259096 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Waleràn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Waleràn
  • harmful:false
  • if_expr:
 
Mindbender 8.0 60.52sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 0.00 0.00 0.00 1.0719 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - mindbender
Shadowcrawl 23.5 19.14sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.52 0.00 0.00 0.00 1.0517 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.27% 0.0(0.0) 1.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 12.9 280.7 35.6sec 35.6sec 69.39% 69.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:5.42%
  • insanity_drain_stacks_2:2.93%
  • insanity_drain_stacks_3:2.84%
  • insanity_drain_stacks_4:3.52%
  • insanity_drain_stacks_5:2.86%
  • insanity_drain_stacks_6:2.85%
  • insanity_drain_stacks_7:2.81%
  • insanity_drain_stacks_8:3.25%
  • insanity_drain_stacks_9:2.84%
  • insanity_drain_stacks_10:2.80%
  • insanity_drain_stacks_11:2.96%
  • insanity_drain_stacks_12:2.86%
  • insanity_drain_stacks_13:2.82%
  • insanity_drain_stacks_14:2.80%
  • insanity_drain_stacks_15:2.89%
  • insanity_drain_stacks_16:2.79%
  • insanity_drain_stacks_17:2.60%
  • insanity_drain_stacks_18:2.57%
  • insanity_drain_stacks_19:2.42%
  • insanity_drain_stacks_20:2.02%
  • insanity_drain_stacks_21:2.04%
  • insanity_drain_stacks_22:1.72%
  • insanity_drain_stacks_23:1.31%
  • insanity_drain_stacks_24:1.26%
  • insanity_drain_stacks_25:1.09%
  • insanity_drain_stacks_26:0.81%
  • insanity_drain_stacks_27:0.65%
  • insanity_drain_stacks_28:0.53%
  • insanity_drain_stacks_29:0.36%
  • insanity_drain_stacks_30:0.31%
  • insanity_drain_stacks_31:0.23%
  • insanity_drain_stacks_32:0.14%
  • insanity_drain_stacks_33:0.07%
  • insanity_drain_stacks_34:0.04%
  • insanity_drain_stacks_35:0.01%
  • insanity_drain_stacks_36:0.00%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 12.9 0.0 34.8sec 34.8sec 28.68% 28.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_15:0.07%
  • lingering_insanity_16:0.49%
  • lingering_insanity_17:1.80%
  • lingering_insanity_18:1.36%
  • lingering_insanity_19:1.23%
  • lingering_insanity_20:0.82%
  • lingering_insanity_21:0.72%
  • lingering_insanity_22:1.16%
  • lingering_insanity_23:4.21%
  • lingering_insanity_24:2.41%
  • lingering_insanity_25:0.93%
  • lingering_insanity_26:1.75%
  • lingering_insanity_27:1.20%
  • lingering_insanity_28:1.49%
  • lingering_insanity_29:2.51%
  • lingering_insanity_30:1.70%
  • lingering_insanity_31:1.12%
  • lingering_insanity_32:0.83%
  • lingering_insanity_33:0.52%
  • lingering_insanity_34:0.47%
  • lingering_insanity_35:0.54%
  • lingering_insanity_36:0.50%
  • lingering_insanity_37:0.39%
  • lingering_insanity_38:0.22%
  • lingering_insanity_39:0.18%
  • lingering_insanity_40:0.05%
  • lingering_insanity_41:0.02%
  • lingering_insanity_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 411.0sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Twist of Fate 1.0 162.5 0.0sec 1.0sec 36.28% 36.33% 162.5(162.5) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:36.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 7.5 0.0 63.2sec 63.2sec 6.63% 6.63% 0.0(0.0) 7.4

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 12.9 0.0 35.6sec 35.6sec 69.39% 69.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.85%
  • voidform_2:2.85%
  • voidform_3:2.84%
  • voidform_4:2.84%
  • voidform_5:2.83%
  • voidform_6:2.82%
  • voidform_7:2.82%
  • voidform_8:2.81%
  • voidform_9:2.81%
  • voidform_10:2.80%
  • voidform_11:2.80%
  • voidform_12:2.79%
  • voidform_13:2.78%
  • voidform_14:2.78%
  • voidform_15:2.77%
  • voidform_16:2.73%
  • voidform_17:2.60%
  • voidform_18:2.47%
  • voidform_19:2.30%
  • voidform_20:2.19%
  • voidform_21:2.13%
  • voidform_22:2.02%
  • voidform_23:1.79%
  • voidform_24:1.48%
  • voidform_25:1.35%
  • voidform_26:1.23%
  • voidform_27:1.10%
  • voidform_28:0.95%
  • voidform_29:0.77%
  • voidform_30:0.55%
  • voidform_31:0.42%
  • voidform_32:0.31%
  • voidform_33:0.26%
  • voidform_34:0.20%
  • voidform_35:0.16%
  • voidform_36:0.10%
  • voidform_37:0.06%
  • voidform_38:0.03%
  • voidform_39:0.01%
  • voidform_40:0.00%
  • voidform_41:0.00%
  • voidform_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Increases all damage you deal by {$194249s1=20}%{$?s8092=true}[, reduces the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and grants an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 23.5 0.0 19.1sec 19.1sec 86.70% 70.04% 0.0(0.0) 15.6

Buff details

  • buff initial source:Waleràn_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Waleràn
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Waleràn
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 89.63 353.06 (641.57%) 3.94 5.47 1.52%
Insanity Drained by Voidform Insanity 6251.46 -4448.79 (-8084.23%) -0.71 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 62.35 747.24 (1357.87%) 11.98 0.96 0.13%
Insanity Gained from Mind Flay Insanity 441.72 883.35 (1605.21%) 2.00 0.10 0.01%
Insanity Gained from Mindbender Insanity 109.35 419.29 (761.92%) 3.83 18.11 4.14%
Insanity Gained from Shadow Word: Death Insanity 15.81 423.85 (770.21%) 26.81 50.48 10.64%
Insanity Gained from Shadow Word: Pain Casts Insanity 3.04 9.09 (16.52%) 2.99 0.02 0.20%
Insanity Gained from Vampiric Touch Casts Insanity 1.04 4.15 (7.53%) 3.99 0.01 0.14%
Insanity Gained from Void Bolt Insanity 86.17 1307.00 (2375.04%) 15.17 71.74 5.20%
Insanity Saved by Void Torrent Insanity 592.92 356.80 (648.36%) 0.60 0.00 0.00%
Health from Vampiric Touch Ticks Health 220.63 0.00 (0.00%) 0.00 9044098.31 100.00%
Resource RPS-Gain RPS-Loss
Insanity 10.00 9.87
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 55.02 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 90.5 4.9sec
Void Eruption casted when a target with both DoTs was up 12.9 35.6sec

Statistics & Data Analysis

Fight Length
Sample Data Waleràn Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Waleràn Damage Per Second
Count 9999
Mean 212780.37
Minimum 197334.79
Maximum 235571.91
Spread ( max - min ) 38237.12
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 3882.4176
5th Percentile 206658.77
95th Percentile 219356.51
( 95th Percentile - 5th Percentile ) 12697.73
Mean Distribution
Standard Deviation 38.8261
95.00% Confidence Intervall ( 212704.27 - 212856.47 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1278
0.1 Scale Factor Error with Delta=300 128673
0.05 Scale Factor Error with Delta=300 514692
0.01 Scale Factor Error with Delta=300 12867321
Priority Target DPS
Sample Data Waleràn Priority Target Damage Per Second
Count 9999
Mean 212780.37
Minimum 197334.79
Maximum 235571.91
Spread ( max - min ) 38237.12
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 3882.4176
5th Percentile 206658.77
95th Percentile 219356.51
( 95th Percentile - 5th Percentile ) 12697.73
Mean Distribution
Standard Deviation 38.8261
95.00% Confidence Intervall ( 212704.27 - 212856.47 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1278
0.1 Scale Factor Error with Delta=300 128673
0.05 Scale Factor Error with Delta=300 514692
0.01 Scale Factor Error with Delta=300 12867321
DPS(e)
Sample Data Waleràn Damage Per Second (Effective)
Count 9999
Mean 212780.37
Minimum 197334.79
Maximum 235571.91
Spread ( max - min ) 38237.12
Range [ ( max - min ) / 2 * 100% ] 8.99%
Damage
Sample Data Waleràn Damage
Count 9999
Mean 88818742.03
Minimum 67837187.88
Maximum 111936361.06
Spread ( max - min ) 44099173.18
Range [ ( max - min ) / 2 * 100% ] 24.83%
DTPS
Sample Data Waleràn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Waleràn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Waleràn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Waleràn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Waleràn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Waleràn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data WalerànTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Waleràn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
7 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
8 0.00 call_action_list,name=vf,if=buff.voidform.up
9 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
A 2.99 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.67 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.04 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 12.86 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
E 2.45 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 18.19 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
G 22.44 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
H 4.97 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
I 0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
J 5.85 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
K 0.41 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
L 79.92 void_bolt
M 7.50 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
N 4.68 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
O 43.31 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
P 8.68 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
Q 0.36 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
R 0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
S 76.51 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

01245ABCGDMLOSLSLOSLSLOSLSLOSLSLOSLSFGFGDSJOSLSLOHLSLOSLMLOSLSFGFGDSLSLOSLSLOGFGDSJOHLSLOSLMLOSLSLOSLSFGFGDSJOSLSLOSLSFGAFGDSJSLMLOSLSLOSLSFGFGBFDSKSLOSLSLOGAGFGDSLMLOSLSLOSLSLOSGFGFGBDSLOPLSLOSLHPLOSLSLNOLMLONLSFGEFDSLSLOPLSLOSLSLEFGAEDOSLSLOPLMLOSLPSLOSLSLNOLNSLOGFG6DPOJSLOSLPHLOSLSLOPLSLMLONLSFG

Sample Sequence Table

time name target resources buffs
Pre flask Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Waleràn 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.164 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.099 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.034 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:07.803 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:07.803 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:12.055 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity bloodlust, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:12.945 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity bloodlust, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:13.827 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:14.702 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.0/100: 98% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:15.590 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.4/100: 97% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:17.552 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity bloodlust, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:18.401 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:19.244 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity bloodlust, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:20.081 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity bloodlust, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:20.922 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity bloodlust, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:22.882 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity bloodlust, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace
0:23.689 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity bloodlust, voidform(16), insanity_drain_stacks(13)
0:24.496 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity bloodlust, voidform(17), insanity_drain_stacks(14)
0:25.296 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.2/100: 64% insanity bloodlust, voidform(18), insanity_drain_stacks(15)
0:26.090 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity bloodlust, voidform(19), insanity_drain_stacks(16)
0:27.939 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.7/100: 53% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:28.714 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:29.488 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.6/100: 58% insanity bloodlust, voidform(22), insanity_drain_stacks(19)
0:30.255 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:31.016 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.5/100: 49% insanity bloodlust, voidform(24), insanity_drain_stacks(21)
0:32.731 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity bloodlust, voidform(25), insanity_drain_stacks(22)
0:33.483 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.2/100: 26% insanity bloodlust, voidform(26), insanity_drain_stacks(23)
0:34.237 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.2/100: 23% insanity bloodlust, voidform(27), insanity_drain_stacks(24)
0:34.993 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, voidform(28), insanity_drain_stacks(25)
0:35.749 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.3/100: 12% insanity bloodlust, voidform(28), insanity_drain_stacks(25)
0:37.504 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity bloodlust, lingering_insanity(29)
0:38.260 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity bloodlust, lingering_insanity(29)
0:43.798 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(29)
0:44.740 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity lingering_insanity(29)
0:48.334 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(29)
0:48.334 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity voidform, insanity_drain_stacks
0:51.065 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity voidform(3), insanity_drain_stacks(3)
0:52.244 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity voidform(4), insanity_drain_stacks(4)
0:53.413 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity voidform(6), insanity_drain_stacks(6)
0:54.560 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity voidform(7), insanity_drain_stacks(7)
0:55.727 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity voidform(8), insanity_drain_stacks(8)
0:58.135 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.4/100: 40% insanity voidform(10), insanity_drain_stacks(10)
0:59.239 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.2/100: 41% insanity voidform(11), insanity_drain_stacks(11)
1:00.334 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.7/100: 38% insanity voidform(13), insanity_drain_stacks(13)
1:01.409 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity voidform(14), insanity_drain_stacks(14)
1:02.506 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.3/100: 33% insanity voidform(15), insanity_drain_stacks(15)
1:04.867 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.1/100: 11% insanity voidform(17), insanity_drain_stacks(17)
1:05.905 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.3/100: 17% insanity voidform(18), insanity_drain_stacks(18)
1:06.937 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.8/100: 15% insanity voidform(19), insanity_drain_stacks(19)
1:07.960 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.8/100: 5% insanity voidform(20), insanity_drain_stacks(20)
1:08.988 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.2/100: 5% insanity voidform(21), insanity_drain_stacks(21)
1:13.245 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.4/100: 20% insanity voidform(25), insanity_drain_stacks(21)
1:14.215 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.4/100: 22% insanity voidform(26), insanity_drain_stacks(22)
1:15.179 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.5/100: 19% insanity voidform(27), insanity_drain_stacks(23)
1:16.136 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.5/100: 7% insanity voidform(28), insanity_drain_stacks(24)
1:17.102 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.7/100: 4% insanity voidform(29), insanity_drain_stacks(25)
1:19.219 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(29)
1:20.163 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(29)
1:26.547 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(29)
1:27.491 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(29)
1:28.656 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(29)
1:28.656 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity voidform, insanity_drain_stacks
1:31.316 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity voidform(3), insanity_drain_stacks(3)
1:32.497 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity voidform(4), insanity_drain_stacks(4)
1:35.087 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity voidform(7), insanity_drain_stacks(7)
1:36.221 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.3/100: 55% insanity voidform(8), insanity_drain_stacks(8)
1:37.347 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.4/100: 53% insanity voidform(9), insanity_drain_stacks(9)
1:38.462 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity voidform(10), insanity_drain_stacks(10)
1:39.589 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.1/100: 43% insanity voidform(11), insanity_drain_stacks(11)
1:42.008 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity voidform(14), insanity_drain_stacks(14)
1:43.075 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.2/100: 15% insanity voidform(15), insanity_drain_stacks(15)
1:44.133 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(16)
1:51.232 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(16)
1:52.281 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(16)
1:56.256 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(16)
1:56.256 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity voidform, insanity_drain_stacks
1:58.774 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity voidform(3), insanity_drain_stacks(3)
1:59.952 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity voidform(4), insanity_drain_stacks(4)
2:01.121 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.5/100: 69% insanity voidform(5), insanity_drain_stacks(5)
2:02.276 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity voidform(7), insanity_drain_stacks(7)
2:03.437 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.1/100: 66% insanity voidform(8), insanity_drain_stacks(8)
2:05.988 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.7/100: 50% insanity voidform(10), insanity_drain_stacks(10)
2:07.092 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity voidform(11), insanity_drain_stacks(11)
2:08.186 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.2/100: 55% insanity voidform(12), insanity_drain_stacks(12)
2:09.271 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.7/100: 47% insanity voidform(14), insanity_drain_stacks(14)
2:10.359 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.1/100: 54% insanity voidform(15), insanity_drain_stacks(15)
2:14.610 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.1/100: 70% insanity voidform(19), insanity_drain_stacks(15)
2:15.631 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.1/100: 78% insanity voidform(20), insanity_drain_stacks(16)
2:16.645 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity voidform(21), insanity_drain_stacks(17)
2:17.650 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.7/100: 61% insanity voidform(22), insanity_drain_stacks(18)
2:18.660 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity voidform(23), insanity_drain_stacks(19)
2:20.843 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.1/100: 31% insanity voidform(25), insanity_drain_stacks(21)
2:21.816 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.1/100: 28% insanity voidform(26), insanity_drain_stacks(22)
2:22.782 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.5/100: 21% insanity voidform(27), insanity_drain_stacks(23)
2:23.739 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.5/100: 10% insanity voidform(28), insanity_drain_stacks(24)
2:24.701 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity voidform(29), insanity_drain_stacks(25)
2:26.898 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(29)
2:27.841 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(29)
2:34.208 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(29)
2:35.149 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(29)
2:38.804 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(29)
2:38.804 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity voidform, insanity_drain_stacks
2:41.489 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity voidform(3), insanity_drain_stacks(3)
2:42.667 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity voidform(4), insanity_drain_stacks(4)
2:43.838 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity voidform(6), insanity_drain_stacks(6)
2:44.984 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity voidform(7), insanity_drain_stacks(7)
2:46.152 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity voidform(8), insanity_drain_stacks(8)
2:48.720 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.1/100: 39% insanity voidform(10), insanity_drain_stacks(10)
2:49.825 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.8/100: 40% insanity voidform(12), insanity_drain_stacks(12)
2:50.911 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.2/100: 36% insanity voidform(13), insanity_drain_stacks(13)
2:51.986 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.5/100: 24% insanity voidform(14), insanity_drain_stacks(14)
2:53.087 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.7/100: 24% insanity voidform(15), insanity_drain_stacks(15)
2:55.477 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(17)
2:56.516 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(17)
3:01.983 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(17)
3:03.024 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(17)
3:04.064 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(17)
3:05.760 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity lingering_insanity(17)
3:05.760 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity voidform, insanity_drain_stacks
3:08.418 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity voidform(3), insanity_drain_stacks(3)
3:09.596 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity voidform(4), insanity_drain_stacks(4)
3:12.271 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity voidform(7), insanity_drain_stacks(7)
3:13.407 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity voidform(8), insanity_drain_stacks(8)
3:17.658 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity voidform(12), insanity_drain_stacks(8)
3:18.743 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity voidform(13), insanity_drain_stacks(9)
3:19.820 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity voidform(15), insanity_drain_stacks(11)
3:20.877 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity voidform(16), insanity_drain_stacks(12)
3:21.950 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.8/100: 78% insanity voidform(17), insanity_drain_stacks(13)
3:24.368 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.4/100: 48% insanity voidform(19), insanity_drain_stacks(15)
3:25.389 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.4/100: 48% insanity voidform(20), insanity_drain_stacks(16)
3:26.404 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.7/100: 44% insanity voidform(21), insanity_drain_stacks(17)
3:27.408 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.7/100: 31% insanity voidform(22), insanity_drain_stacks(18)
3:28.419 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.2/100: 28% insanity voidform(23), insanity_drain_stacks(19)
3:30.555 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(25)
3:31.527 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity lingering_insanity(25)
3:38.058 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(25)
3:39.032 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(25)
3:43.687 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(25)
3:44.659 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity lingering_insanity(25)
3:45.811 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity lingering_insanity(25)
3:45.811 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity voidform, insanity_drain_stacks
3:48.520 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.9/100: 68% insanity voidform(3), insanity_drain_stacks(3)
3:49.700 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity voidform(4), insanity_drain_stacks(4)
3:52.244 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity voidform(7), insanity_drain_stacks(7)
3:53.379 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity voidform(8), insanity_drain_stacks(8)
3:54.506 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.3/100: 52% insanity voidform(9), insanity_drain_stacks(9)
3:55.620 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity voidform(10), insanity_drain_stacks(10)
3:56.744 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.1/100: 42% insanity voidform(11), insanity_drain_stacks(11)
3:59.172 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.4/100: 14% insanity voidform(14), insanity_drain_stacks(14)
4:00.238 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.2/100: 14% insanity voidform(15), insanity_drain_stacks(15)
4:01.295 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(16)
4:02.680 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(16)
4:03.729 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(16)
4:07.625 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(16)
4:08.673 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(16)
4:10.466 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity lingering_insanity(16)
4:10.466 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity voidform, insanity_drain_stacks
4:13.056 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity voidform(3), insanity_drain_stacks(3)
4:14.236 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity voidform(4), insanity_drain_stacks(4)
4:18.425 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.0/100: 98% insanity voidform(8), insanity_drain_stacks(4)
4:19.551 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity voidform(10), insanity_drain_stacks(6)
4:20.657 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity voidform(11), insanity_drain_stacks(7)
4:21.753 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity voidform(12), insanity_drain_stacks(8)
4:22.874 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity voidform(13), insanity_drain_stacks(9)
4:25.255 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.8/100: 57% insanity voidform(15), insanity_drain_stacks(11)
4:26.312 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.1/100: 58% insanity voidform(16), insanity_drain_stacks(12)
4:27.362 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.5/100: 55% insanity voidform(17), insanity_drain_stacks(13)
4:28.400 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.7/100: 47% insanity voidform(18), insanity_drain_stacks(14)
4:29.444 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity voidform(19), insanity_drain_stacks(15)
4:31.731 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.9/100: 20% insanity voidform(22), insanity_drain_stacks(18)
4:32.728 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.6/100: 19% insanity voidform(23), insanity_drain_stacks(19)
4:33.714 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.5/100: 14% insanity voidform(24), insanity_drain_stacks(20)
4:34.695 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(25)
4:37.751 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(25)
4:38.724 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(25)
4:45.274 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(25)
4:46.245 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(25)
4:47.486 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(25)
4:48.458 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity lingering_insanity(25)
4:48.458 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity voidform, insanity_drain_stacks
4:51.151 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.4/100: 66% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:52.331 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.4/100: 70% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
4:53.497 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6)
4:54.644 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
4:55.815 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
4:58.382 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.7/100: 62% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:59.489 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:00.573 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.7/100: 59% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:01.649 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:02.752 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:03.809 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.6/100: 33% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:04.856 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.2/100: 50% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:05.911 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.5/100: 56% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:06.943 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:07.963 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.1/100: 39% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:08.990 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.6/100: 45% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:11.272 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:12.261 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:13.241 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.2/100: 30% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25)
5:14.215 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26)
5:15.191 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.5/100: 28% insanity twist_of_fate, voidform(27), insanity_drain_stacks(27)
5:19.495 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.9/100: 30% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
5:20.417 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
5:21.340 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.3/100: 16% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29)
5:22.253 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.6/100: 30% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30)
5:23.162 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity twist_of_fate, voidform(35), insanity_drain_stacks(31)
5:25.177 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(37)
5:26.065 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(37)
5:31.182 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, lingering_insanity(37)
5:32.070 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(37)
5:32.960 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, lingering_insanity(37)
5:32.960 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, voidform, insanity_drain_stacks
5:35.611 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:36.791 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.9/100: 76% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
5:39.249 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:40.386 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.1/100: 67% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:41.510 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
5:42.625 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.4/100: 80% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
5:43.750 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:46.279 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:47.344 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:48.401 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:49.449 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:50.505 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.1/100: 32% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:52.928 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.4/100: 0% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:53.942 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(21)
5:54.947 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity twist_of_fate, lingering_insanity(21)
5:55.952 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, lingering_insanity(21)
6:02.669 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity twist_of_fate, lingering_insanity(21)
6:03.757 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity twist_of_fate, lingering_insanity(21)
6:04.761 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, lingering_insanity(21)
6:04.761 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform, insanity_drain_stacks
6:05.964 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.5/100: 100% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
6:07.156 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.2/100: 93% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
6:08.338 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
6:10.930 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
6:12.066 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.8/100: 93% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
6:13.192 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
6:14.307 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
6:15.431 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
6:19.673 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 96% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
6:20.732 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
6:21.781 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.5/100: 82% insanity twist_of_fate, voidform(18), insanity_drain_stacks(14)
6:22.812 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, voidform(19), insanity_drain_stacks(15)
6:23.854 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, voidform(20), insanity_drain_stacks(16)
6:24.868 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.1/100: 83% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17)
6:25.872 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.1/100: 70% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
6:26.883 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
6:27.873 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
6:28.855 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.7/100: 50% insanity twist_of_fate, voidform(25), insanity_drain_stacks(21)
6:29.836 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.7/100: 47% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
6:31.973 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.6/100: 13% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24)
6:32.923 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.4/100: 9% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25)
6:33.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.5/100: 23% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26)
6:34.802 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.5/100: 17% insanity twist_of_fate, voidform(31), insanity_drain_stacks(27)
6:35.740 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.6/100: 20% insanity twist_of_fate, voidform(31), insanity_drain_stacks(27)
6:36.668 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.7/100: 29% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
6:37.589 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29)
6:38.502 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.4/100: 7% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30)
6:39.409 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(35)
6:45.833 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity twist_of_fate, lingering_insanity(35)
6:46.734 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(35)
6:51.452 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(35)
6:51.452 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(35), potion_of_deadly_grace
6:51.452 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, voidform, insanity_drain_stacks, potion_of_deadly_grace
6:52.656 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace
6:53.847 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace
6:55.027 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace
6:57.564 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.2/100: 69% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace
6:58.701 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace
6:59.825 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace
7:00.941 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.5/100: 60% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), potion_of_deadly_grace
7:02.064 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
7:03.159 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
7:04.245 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
7:05.338 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.5/100: 67% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace
7:06.404 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace
7:07.461 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace
7:08.515 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace
7:10.770 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.7/100: 39% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace
7:11.784 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.4/100: 40% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
7:12.787 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.4/100: 37% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22), potion_of_deadly_grace
7:13.782 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23), potion_of_deadly_grace
7:14.786 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24), potion_of_deadly_grace
7:16.982 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26)
7:17.949 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, voidform(27), insanity_drain_stacks(27)
7:22.155 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.5/100: 29% insanity twist_of_fate, voidform(31), insanity_drain_stacks(27)
7:23.083 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.7/100: 25% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
7:24.006 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.2/100: 19% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29)
7:24.921 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.5/100: 29% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30)
7:25.835 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.4/100: 23% insanity twist_of_fate, voidform(35), insanity_drain_stacks(31)
7:27.896 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(36)
7:28.790 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(36)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6259 5934 0
Agility 7825 7500 0
Stamina 28906 28906 18394
Intellect 31500 29794 21049 (665)
Spirit -1 -1 0
Health 1734360 1734360 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 31500 29794 0
Crit 19.47% 19.47% 5065
Haste 23.85% 22.70% 7377
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 61.18% 61.18% 5764
Armor 1586 1586 1586
Run Speed 7 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 846.00
Local Head Night Dreamer Crest
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Haste, +400 Mastery }
Local Neck Chain of the Green Flight
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Crit }
Local Shoulders Sunfrost Mantle
ilevel: 835, stats: { 185 Armor, +846 Int, +1269 Sta, +602 Haste, +324 Crit }
Local Chest Dreamscale Inlaid Vestments
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +820 Haste, +484 Mastery }, gems: { +150 Haste }
Local Waist Manawracker Waistcord
ilevel: 835, stats: { 139 Armor, +846 Int, +1269 Sta, +582 Mastery, +343 Haste }
Local Legs Manawracker Pants
ilevel: 830, stats: { 212 Armor, +1077 Int, +1615 Sta, +735 Mastery, +476 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 860, stats: { 185 Armor, +1601 Sta, +1068 Int, +682 Haste, +334 Crit }
Local Wrists Frost-Stricken Cuffs
ilevel: 850, stats: { 114 Armor, +1094 Sta, +729 Int, +461 Mastery, +273 Crit, +314 Leech }
Local Hands Terrorweave Gloves
ilevel: 835, stats: { 154 Armor, +846 Int, +1269 Sta, +621 Crit, +304 Haste }, gems: { +150 Haste }
Local Finger1 Dingy Wedding Band
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }, enchant: { +150 Crit }
Local Finger2 Band of Twisted Bark
ilevel: 840, stats: { +997 Sta, +1213 Crit, +555 Mastery }, enchant: { +150 Crit }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 840, stats: { +1123 Int, +898 Crit }
Local Trinket2 Vindictive Combatant's Accolade of Dominance
ilevel: 840, stats: { +1123 Int, +898 Haste }
Local Back Dreamwalker's Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +505 Haste, +202 Mastery }, enchant: { +150 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 869, weapon: { 1361 - 2530, 1.8 }, stats: { +664 Int, +996 Sta, +305 Crit, +293 Mastery, +8447 Int }, relics: { +36 ilevels, +40 ilevels, +43 ilevels }
Local Off Hand Secrets of the Void
ilevel: 869, stats: { +871 Int, +1306 Sta, +546 Haste, +242 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Waleràn"
origin="https://eu.api.battle.net/wow/character/hyjal/Waleràn/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/196/115587524-avatar.jpg"
level=110
race=dwarf
role=spell
position=back
professions=engineering=702/inscription=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Xb!0111120
artifact=47:0:0:0:0:764:1:765:1:767:3:770:1:771:3:772:3:773:3:775:2:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=night_dreamer_crest,id=139086,bonus_id=1727/1512/3336
neck=chain_of_the_green_flight,id=137311,bonus_id=1727/1492/1813
shoulders=sunfrost_mantle,id=139129,bonus_id=3432/1497/1674
back=dreamwalkers_cloak,id=139074,bonus_id=3432/1502/3336,enchant=150int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1807/1808/1472,gems=150haste
wrists=froststricken_cuffs,id=133614,bonus_id=3410/41/1502/3336
hands=terrorweave_gloves,id=121325,bonus_id=3397/1808/1497/3336,gems=150haste
waist=manawracker_waistcord,id=134303,bonus_id=3397/1497/3336
legs=manawracker_pants,id=134306,bonus_id=3397/1492/1675
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1482/3336
finger1=dingy_wedding_band,id=134534,bonus_id=3410/1502/3336,enchant=150crit
finger2=band_of_twisted_bark,id=134531,bonus_id=1727/1492/1813,enchant=150crit
trinket1=nightborne_researchers_phial,id=134292,bonus_id=3432/603/1502/3336
trinket2=vindictive_combatants_accolade_of_dominance,id=135924,bonus_id=3428/604/1502/1813
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=142063/140425/138226/0,relic_id=0/3428:1632:1813/1807:1472/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=845.81
# gear_stamina=18394
# gear_intellect=21049
# gear_crit_rating=5065
# gear_haste_rating=7377
# gear_mastery_rating=5764
# gear_leech_rating=314
# gear_armor=1586

Ptitfille

Ptitfille : 295402 dps

  • Race: Human
  • Class: Rogue
  • Spec: Assassination
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
295401.8 295401.8 187.3 / 0.063% 37570.0 / 12.7% 12029.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.5 24.5 Energy 43.33% 34.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Thuggee (Assassination Rogue)
  • 90: Exsanguinate
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact
Professions
  • alchemy: 784
  • herbalism: 800

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Ptitfille 295402
auto_attack_mh 12882 4.4% 279.4 1.62sec 20759 12962 Direct 279.4 17743 35474 20759 36.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 279.42 279.42 0.00 0.00 1.6015 0.0000 5800570.54 8527388.14 31.98 12962.34 12962.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.69 44.98% 17742.72 14445 24865 17746.03 16801 18943 2230051 3278387 31.98
crit 100.65 36.02% 35473.68 28890 49730 35479.34 33546 38173 3570519 5249001 31.98
miss 53.08 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 6397 2.2% 277.6 1.62sec 10376 6425 Direct 277.6 8872 17745 10376 36.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 277.61 277.61 0.00 0.00 1.6150 0.0000 2880405.84 4234469.43 31.98 6424.56 6424.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.89 44.99% 8872.03 7222 12433 8873.26 8410 9371 1108082 1628985 31.98
crit 99.88 35.98% 17744.68 14445 24865 17746.83 16637 18921 1772324 2605484 31.98
miss 52.83 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 12130 4.1% 501.8 1.03sec 10890 0 Periodic 149.5 26858 53740 36558 36.1% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 501.82 0.00 149.49 149.49 0.0000 3.0000 5464962.95 5464962.95 0.00 12186.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.5 63.92% 26857.66 21626 38854 26862.30 25259 29013 2566195 2566195 0.00
crit 53.9 36.08% 53740.36 43251 77708 53746.25 48918 58521 2898768 2898768 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.357500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 25615 8.7% 500.8 1.03sec 23034 0 Direct 500.8 16925 33854 23034 36.1% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 500.82 500.82 0.00 0.00 0.0000 0.0000 11535770.57 11535770.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 320.09 63.91% 16924.79 13369 24019 16926.72 16100 18029 5417589 5417589 0.00
crit 180.72 36.09% 33853.73 26737 48037 33857.35 31920 36425 6118182 6118182 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 26977 9.1% 34.3 12.92sec 353930 352345 Direct 34.3 260348 520864 353927 35.9% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.34 34.34 0.00 0.00 1.0045 0.0000 12153438.99 12153438.99 0.00 352345.08 352345.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.00 64.08% 260347.70 196163 422921 260360.39 225507 302412 5728918 5728918 0.00
crit 12.33 35.92% 520864.49 392326 845841 520813.19 418481 636287 6424521 6424521 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Garrote 27882 9.4% 29.6 15.48sec 423718 421822 Periodic 260.0 35492 71015 48304 36.1% 0.0% 98.1%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.64 0.00 260.00 260.00 1.0045 1.7007 12558906.92 12558906.92 0.00 26610.90 421822.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 166.2 63.93% 35491.87 6414 75158 35508.10 33328 38641 5899636 5899636 0.00
crit 93.8 36.07% 71014.55 11155 150316 71043.57 65115 78618 6659271 6659271 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}. Silences the target for {$1330d=3 seconds} when used from Stealth. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Kingsbane 11915 (16394) 4.0% (5.6%) 10.0 46.55sec 737846 734586 Periodic 68.9 57251 114590 77911 36.0% 0.0% 30.6%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 0.00 68.87 68.87 1.0045 2.0000 5365616.71 5365616.71 0.00 49958.92 734586.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.1 63.97% 57251.36 18947 147938 57258.57 43532 72360 2522194 2522194 0.00
crit 24.8 36.03% 114589.65 37895 295876 114638.69 80243 153571 2843423 2843423 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 2987 1.0% 10.0 46.55sec 134435 0 Direct 10.0 98887 197877 134433 35.9% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 0.00 0.00 0.0000 0.0000 1345235.82 1345235.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 64.09% 98887.50 95348 109577 98876.81 0 109577 634203 634203 0.00
crit 3.59 35.91% 197877.08 190697 219154 194932.78 0 219154 711032 711032 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 1493 0.5% 10.0 46.55sec 67203 0 Direct 10.0 49484 98880 67201 35.9% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 0.00 0.00 0.0000 0.0000 672475.86 672475.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 64.13% 49483.61 47674 54788 49490.88 47674 54788 317545 317545 0.00
crit 3.59 35.87% 98880.04 95348 109577 97414.56 0 109577 354930 354930 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mutilate 0 (43933) 0.0% (14.9%) 134.8 3.34sec 146781 146124

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.78 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 146124.26 146124.26
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 29295 9.9% 134.8 3.34sec 97876 0 Direct 134.8 71916 143845 97873 36.1% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.78 134.78 0.00 0.00 0.0000 0.0000 13191510.84 19392770.47 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.14 63.91% 71915.94 57313 98468 71928.56 68001 77031 6194677 9106762 31.98
crit 48.64 36.09% 143845.16 114626 196936 143846.52 131304 158397 6996834 10286008 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $5374sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 14638 5.0% 134.8 3.34sec 48905 0 Direct 134.8 35964 71890 48906 36.0% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.78 134.78 0.00 0.00 0.0000 0.0000 6591376.21 9689947.38 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.23 63.98% 35963.67 28655 49231 35970.43 34105 38244 3101115 4558933 31.98
crit 48.55 36.02% 71889.92 57309 98462 71887.61 65271 78802 3490261 5131014 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $5374sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 10306 3.5% 44.8 7.90sec 103673 0 Direct 44.8 76267 152519 103670 35.9% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.79 44.79 0.00 0.00 0.0000 0.0000 4643640.39 4643640.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.69 64.06% 76267.24 72592 87239 76276.59 72592 87239 2188397 2188397 0.00
crit 16.10 35.94% 152519.00 145184 174478 152526.55 145184 174478 2455244 2455244 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 11897 4.0% 22.8 5.57sec 230963 0 Direct 22.8 170016 340009 230964 35.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 0.0000 0.0000 5273845.61 7753052.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.65 64.15% 170015.53 151674 174425 170005.19 160424 174425 2490315 3660998 31.98
crit 8.19 35.85% 340008.86 303348 348850 339959.17 0 348850 2783531 4092054 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 89914 30.5% 30.2 15.08sec 1342293 1336300 Periodic 311.0 95608 191437 130181 36.1% 0.0% 97.5%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.17 0.00 311.03 311.03 1.0045 1.4122 40491232.83 40491232.83 0.00 86236.33 1336300.22
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 198.8 63.92% 95608.33 58 311392 95665.20 79235 122872 19009471 19009471 0.00
crit 112.2 36.08% 191437.11 116 622785 191537.27 153276 253102 21481762 21481762 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled&talent.exsanguinate.enabled
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${4+$<bonus>*1*0.275*$AP*8/2} over 8 sec 2 points: ${12+$<bonus>*2*0.275*$AP*12/2} over 12 sec 3 points: ${24+$<bonus>*3*0.275*$AP*16/2} over 16 sec 4 points: ${40+$<bonus>*4*0.275*$AP*20/2} over 20 sec 5 points: ${60+$<bonus>*5*0.275*$AP*24/2} over 24 sec{$?s193531=false}[ 6 points: ${84+$<bonus>*6*0.275*$AP*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Wind Bolt 11075 3.8% 53.9 7.18sec 92488 0 Direct 53.9 67987 135962 92505 36.1% 0.0%  

Stats details: wind_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.92 53.91 0.00 0.00 0.0000 0.0000 4986667.50 4986667.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.46 63.93% 67987.21 61551 70784 67989.41 64069 70784 2343110 2343110 0.00
crit 19.44 36.07% 135961.60 123102 141567 135961.22 123102 141567 2643557 2643557 0.00
 
 

Action details: wind_bolt

Static Values
  • id:227870
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227870
  • name:Wind Bolt
  • school:nature
  • tooltip:Movement speed reduced by {$s2=30}%.
  • description:{$@spelldesc227868=Your attacks have a chance to launch a volley of 6 Wind Bolts, each dealing {$227870s1=30697 to 33928} Nature damage and slowing your target by {$227870s2=30}% for {$227870d=6 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:44555.00
  • base_dd_max:49245.00
 
Simple Action Stats Execute Interval
Ptitfille
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
Exsanguinate 10.0 46.56sec

Stats details: exsanguinate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: exsanguinate

Static Values
  • id:200806
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
Spelldata
  • id:200806
  • name:Exsanguinate
  • school:physical
  • tooltip:
  • description:Twist your blades into the target's wounds, causing your Bleed effects on them to bleed out {$s1=100}% faster.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ptitfille
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 3.6 139.65sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 5.3 92.59sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 8.68% 0.0(0.0) 1.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 57.1 7.4 7.9sec 7.0sec 69.67% 58.06% 7.4(7.4) 56.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:69.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 24.8 9.6 18.0sec 12.9sec 49.76% 48.88% 9.6(9.6) 24.3

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:49.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Infernal Alchemist Stone 6.7 1.8 63.6sec 48.3sec 24.71% 24.77% 1.8(1.8) 6.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_infernal_alchemist_stone
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4536.88

Stack Uptimes

  • infernal_alchemist_stone_1:24.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188026
  • name:Infernal Alchemist Stone
  • tooltip:
  • description:When you heal or deal damage you have a chance to increase your Strength, Agility, or Intellect by {$s1=3126} for {$60229d=15 seconds}. Your highest stat is always chosen.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 94.9sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Six-Feather Fan 8.5 0.8 49.6sec 45.0sec 10.08% 10.14% 45.4(45.4) 8.4

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_sixfeather_fan
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sixfeather_fan_1:10.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227869
  • name:Six-Feather Fan
  • tooltip:Launching Wind Bolts at your target, each causing {$227870s1=30697 to 33928} damage and slowing them by {$227870s2=30}%.
  • description:{$@spelldesc227868=Your attacks have a chance to launch a volley of 6 Wind Bolts, each dealing {$227870s1=30697 to 33928} Nature damage and slowing your target by {$227870s2=30}% for {$227870d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:225.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 3.6 0.0 139.7sec 139.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Ptitfille
envenom Energy 34.3 1201.8 35.0 35.0 10112.4
envenom Combo Points 34.3 193.5 5.6 5.6 62824.3
garrote Energy 29.6 1333.8 45.0 45.0 9416.0
kingsbane Energy 10.0 350.2 35.0 35.0 21081.3
mutilate Energy 134.8 7412.7 55.0 55.0 2668.8
rupture Energy 30.2 754.1 25.0 25.0 53692.1
rupture Combo Points 30.2 171.4 5.7 5.7 236259.4
Resource Gains Type Count Total Average Overflow
mutilate Combo Points 134.78 263.04 (71.55%) 1.95 6.52 2.42%
garrote Combo Points 29.64 29.64 (8.06%) 1.00 0.00 0.00%
energy_regen Energy 2658.64 4923.73 (44.88%) 1.85 51.86 1.04%
seal_fate Combo Points 97.19 74.94 (20.39%) 0.77 22.24 22.89%
Venomous Vim Energy 570.99 5595.86 (51.01%) 9.80 114.07 2.00%
Urge to Kill Energy 5.35 451.35 (4.11%) 84.40 190.39 29.67%
Resource RPS-Gain RPS-Loss
Energy 24.35 24.53
Combo Points 0.82 0.81
Combat End Resource Mean Min Max
Energy 37.97 0.04 120.00
Combo Points 2.83 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
Seal Fate 97.2 5.6sec

Statistics & Data Analysis

Fight Length
Sample Data Ptitfille Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Ptitfille Damage Per Second
Count 9999
Mean 295401.84
Minimum 264064.85
Maximum 340242.75
Spread ( max - min ) 76177.90
Range [ ( max - min ) / 2 * 100% ] 12.89%
Standard Deviation 9553.7079
5th Percentile 280148.29
95th Percentile 311678.28
( 95th Percentile - 5th Percentile ) 31529.99
Mean Distribution
Standard Deviation 95.5419
95.00% Confidence Intervall ( 295214.58 - 295589.10 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4018
0.1 Scale Factor Error with Delta=300 779161
0.05 Scale Factor Error with Delta=300 3116646
0.01 Scale Factor Error with Delta=300 77916167
Priority Target DPS
Sample Data Ptitfille Priority Target Damage Per Second
Count 9999
Mean 295401.84
Minimum 264064.85
Maximum 340242.75
Spread ( max - min ) 76177.90
Range [ ( max - min ) / 2 * 100% ] 12.89%
Standard Deviation 9553.7079
5th Percentile 280148.29
95th Percentile 311678.28
( 95th Percentile - 5th Percentile ) 31529.99
Mean Distribution
Standard Deviation 95.5419
95.00% Confidence Intervall ( 295214.58 - 295589.10 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4018
0.1 Scale Factor Error with Delta=300 779161
0.05 Scale Factor Error with Delta=300 3116646
0.01 Scale Factor Error with Delta=300 77916167
DPS(e)
Sample Data Ptitfille Damage Per Second (Effective)
Count 9999
Mean 295401.84
Minimum 264064.85
Maximum 340242.75
Spread ( max - min ) 76177.90
Range [ ( max - min ) / 2 * 100% ] 12.89%
Damage
Sample Data Ptitfille Damage
Count 9999
Mean 132955657.57
Minimum 98327614.55
Maximum 169590845.40
Spread ( max - min ) 71263230.85
Range [ ( max - min ) / 2 * 100% ] 26.80%
DTPS
Sample Data Ptitfille Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Ptitfille Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Ptitfille Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Ptitfille Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Ptitfille Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Ptitfille Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PtitfilleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Ptitfille Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
0.00 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
9 0.00 call_action_list,name=cds
0.00 rupture,if=combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled&talent.exsanguinate.enabled
A 6.65 rupture,if=combo_points>=4&!ticking&talent.exsanguinate.enabled
0.00 pool_resource,for_next=1
B 10.01 kingsbane,if=!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
C 0.00 run_action_list,name=exsang_combo,if=cooldown.exsanguinate.remains<3&talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>25)
D 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
E 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
F 9.87 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
G 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
H 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
I 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
J 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_ex Builders Exsanguinate
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=equipped.the_dreadlords_deceit&((buff.the_dreadlords_deceit.stack>=29|buff.the_dreadlords_deceit.stack>=15&debuff.vendetta.remains<=3)&debuff.vendetta.up|buff.the_dreadlords_deceit.stack>=5&cooldown.vendetta.remains>60&cooldown.vendetta.remains<65)
0.00 hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&(dot.rupture.exsanguinated&dot.rupture.remains<=2|cooldown.exsanguinate.remains<=2))
K 5.12 mutilate,if=combo_points.deficit<=1&energy.deficit<=30
L 129.66 mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2
actions.cds Cooldowns
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
M 0.25 vendetta,if=target.time_to_die<20
N 5.10 vendetta,if=artifact.urge_to_kill.enabled&dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<5)&(energy<55|time<10|spell_targets.fan_of_knives>=2)
0.00 vendetta,if=!artifact.urge_to_kill.enabled&dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1)
0.00 vanish,if=talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2
0.00 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=5+talent.deeper_stratagem.enabled&energy>=25&gcd.remains=0
actions.exsang Exsanguinated Finishers
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
O 3.61 rupture,if=combo_points>=cp_max_spend&ticks_remain<2
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
P 19.63 envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang_combo Exsanguinate Combo
# count action,conditions
Q 3.62 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
R 10.04 rupture,if=combo_points>=cp_max_spend&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)&cooldown.exsanguinate.remains<1
S 10.03 exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
T 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
0.00 hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
U 0.00 call_action_list,name=build_ex
actions.finish_ex Finishers Exsanguinate
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
0.00 rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
V 12.48 envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
W 2.23 envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.garrote Garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
X 29.65 garrote,if=combo_points.deficit>=1&!exsanguinated

Sample Sequence

012456XLANLLKQRSBLLLPXLPLLOLLXFLLVLLWXLLRSBLLPXLLPLLALXVLLFLLWXN8LLRSBLLPLXLPLLOLLFXLLVLLXVLLQRSBLLXPLLPLLALXLFLLVXLLNVLLRSBLLPXLLPLLOLXLFLLVLXLKRSBLLPXLLPLLOLXLFLLVLXLNVLLQRSBLLPXLLPLLALXLFLLLVXLLRSBLLPXLLPLLOLXLFLLVLXLNVLLRSBLLPLXLPLLOLLXFLLLVXLLKQRSBLLPXLLPLLOLXVLLFL

Sample Sequence Table

time name target resources buffs
Pre flask Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Ptitfille 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 86.3/120: 72% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.011 rupture Fluffy_Pillow 55.4/120: 46% energy | 5.0/6: 83% combo_points bloodlust, potion_of_the_old_war
0:03.016 vendetta Fluffy_Pillow 44.5/120: 37% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:03.016 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:04.020 mutilate Fluffy_Pillow 99.0/120: 83% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:05.025 Waiting 1.000 sec 58.1/120: 48% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:06.025 mutilate Fluffy_Pillow 92.1/120: 77% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:07.030 vanish Fluffy_Pillow 51.2/120: 43% energy | 6.0/6: 100% combo_points bloodlust, potion_of_the_old_war
0:07.030 rupture Fluffy_Pillow 51.2/120: 43% energy | 6.0/6: 100% combo_points bloodlust, vanish, potion_of_the_old_war
0:08.035 exsanguinate Fluffy_Pillow 60.2/120: 50% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:09.040 kingsbane Fluffy_Pillow 94.3/120: 79% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:10.046 mutilate Fluffy_Pillow 93.3/120: 78% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:11.050 mutilate Fluffy_Pillow 72.4/120: 60% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:12.056 Waiting 0.300 sec 51.5/120: 43% energy | 4.0/6: 67% combo_points bloodlust, sixfeather_fan, potion_of_the_old_war
0:12.356 mutilate Fluffy_Pillow 55.7/120: 46% energy | 4.0/6: 67% combo_points bloodlust, sixfeather_fan, potion_of_the_old_war
0:13.360 Waiting 0.100 sec 34.7/120: 29% energy | 6.0/6: 100% combo_points bloodlust, sixfeather_fan, potion_of_the_old_war
0:13.460 envenom Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points bloodlust, sixfeather_fan, potion_of_the_old_war
0:14.465 Waiting 0.300 sec 25.2/120: 21% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, sixfeather_fan, potion_of_the_old_war
0:15.277 garrote Fluffy_Pillow 46.5/120: 39% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, sixfeather_fan, potion_of_the_old_war
0:16.281 Waiting 1.000 sec 25.6/120: 21% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning, sixfeather_fan, potion_of_the_old_war
0:17.281 mutilate Fluffy_Pillow 59.6/120: 50% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:18.286 Waiting 0.500 sec 28.6/120: 24% energy | 5.0/6: 83% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:18.786 envenom Fluffy_Pillow 35.6/120: 30% energy | 5.0/6: 83% combo_points bloodlust, envenom, potion_of_the_old_war
0:19.791 Waiting 0.800 sec 34.7/120: 29% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:20.591 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:21.596 Waiting 0.800 sec 34.9/120: 29% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.396 mutilate Fluffy_Pillow 56.1/120: 47% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:23.401 Waiting 1.400 sec 35.2/120: 29% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning
0:24.801 rupture Fluffy_Pillow 64.7/120: 54% energy | 6.0/6: 100% combo_points bloodlust, envenom
0:25.806 mutilate Fluffy_Pillow 73.8/120: 62% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:26.809 Waiting 0.500 sec 32.8/120: 27% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:27.309 mutilate Fluffy_Pillow 59.8/120: 50% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:28.313 Waiting 1.737 sec 18.9/120: 16% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning
0:30.050 garrote Fluffy_Pillow 63.2/120: 53% energy | 5.0/6: 83% combo_points bloodlust
0:31.281 rupture Fluffy_Pillow 55.4/120: 46% energy | 6.0/6: 100% combo_points bloodlust
0:32.284 Waiting 0.800 sec 44.4/120: 37% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:33.084 mutilate Fluffy_Pillow 65.6/120: 55% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:34.089 Waiting 1.000 sec 34.7/120: 29% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:35.089 mutilate Fluffy_Pillow 58.7/120: 49% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:36.093 Waiting 2.400 sec 27.7/120: 23% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning
0:38.493 envenom Fluffy_Pillow 81.3/120: 68% energy | 5.0/6: 83% combo_points bloodlust
0:39.497 mutilate Fluffy_Pillow 80.3/120: 67% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:40.501 Waiting 0.600 sec 39.4/120: 33% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:41.101 mutilate Fluffy_Pillow 57.1/120: 48% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
0:42.107 Waiting 2.191 sec 22.9/120: 19% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
0:44.298 envenom Fluffy_Pillow 66.5/120: 55% energy | 6.0/6: 100% combo_points envenom
0:45.302 garrote Fluffy_Pillow 62.3/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:46.307 Waiting 1.000 sec 28.1/120: 23% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
0:47.307 mutilate Fluffy_Pillow 58.9/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
0:48.311 Waiting 1.957 sec 14.7/120: 12% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
0:50.268 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone
0:51.273 Waiting 0.818 sec 21.6/120: 18% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
0:52.091 rupture Fluffy_Pillow 40.4/120: 34% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
0:53.096 exsanguinate Fluffy_Pillow 36.2/120: 30% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
0:54.101 kingsbane Fluffy_Pillow 67.0/120: 56% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
0:55.104 mutilate Fluffy_Pillow 62.8/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
0:56.109 Waiting 0.600 sec 38.6/120: 32% energy | 3.0/6: 50% combo_points elaborate_planning, infernal_alchemist_stone
0:56.709 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, infernal_alchemist_stone
0:57.712 Waiting 0.400 sec 30.9/120: 26% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
0:58.112 envenom Fluffy_Pillow 45.2/120: 38% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
0:59.116 Waiting 1.800 sec 41.0/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:00.916 garrote Fluffy_Pillow 100.3/120: 84% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:01.921 mutilate Fluffy_Pillow 76.2/120: 63% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
1:02.927 Waiting 0.200 sec 52.0/120: 43% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:03.127 mutilate Fluffy_Pillow 64.1/120: 53% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone
1:04.131 Waiting 0.500 sec 29.9/120: 25% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
1:04.631 envenom Fluffy_Pillow 35.3/120: 29% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
1:05.635 Waiting 1.300 sec 31.1/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:06.935 mutilate Fluffy_Pillow 65.1/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:07.941 Waiting 1.000 sec 30.9/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:08.941 mutilate Fluffy_Pillow 61.7/120: 51% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:09.947 Waiting 0.900 sec 27.5/120: 23% energy | 5.0/6: 83% combo_points envenom, infernal_alchemist_stone
1:10.847 rupture Fluffy_Pillow 57.2/120: 48% energy | 5.0/6: 83% combo_points envenom, infernal_alchemist_stone
1:11.852 Waiting 0.200 sec 53.0/120: 44% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:12.052 mutilate Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:13.056 Waiting 2.700 sec 31.0/120: 26% energy | 4.0/6: 67% combo_points elaborate_planning, infernal_alchemist_stone
1:15.756 garrote Fluffy_Pillow 80.0/120: 67% energy | 4.0/6: 67% combo_points elaborate_planning, infernal_alchemist_stone
1:16.920 Waiting 1.200 sec 67.6/120: 56% energy | 5.0/6: 83% combo_points infernal_alchemist_stone
1:18.120 envenom Fluffy_Pillow 80.5/120: 67% energy | 5.0/6: 83% combo_points infernal_alchemist_stone
1:19.124 mutilate Fluffy_Pillow 76.3/120: 64% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:20.130 Waiting 0.800 sec 32.1/120: 27% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:20.930 mutilate Fluffy_Pillow 60.7/120: 51% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:21.933 Waiting 0.890 sec 16.5/120: 14% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:22.823 rupture Fluffy_Pillow 26.1/120: 22% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:23.828 Waiting 1.100 sec 31.9/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
1:24.928 mutilate Fluffy_Pillow 63.7/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
1:25.933 Waiting 1.507 sec 19.5/120: 16% energy | 3.0/6: 50% combo_points elaborate_planning
1:27.440 mutilate Fluffy_Pillow 55.8/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
1:28.444 Waiting 1.549 sec 11.6/120: 10% energy | 6.0/6: 100% combo_points
1:29.993 envenom Fluffy_Pillow 48.2/120: 40% energy | 6.0/6: 100% combo_points sixfeather_fan
1:31.254 garrote Fluffy_Pillow 46.8/120: 39% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
1:32.260 Waiting 1.150 sec 12.6/120: 11% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan
1:33.410 vendetta Fluffy_Pillow 45.0/120: 37% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan
1:33.410 potion Fluffy_Pillow 120.0/120: 100% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan
1:33.410 mutilate Fluffy_Pillow 120.0/120: 100% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan, potion_of_the_old_war
1:34.416 mutilate Fluffy_Pillow 75.8/120: 63% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, sixfeather_fan, potion_of_the_old_war
1:35.421 Waiting 1.700 sec 51.6/120: 43% energy | 6.0/6: 100% combo_points envenom, potion_of_the_old_war
1:37.121 rupture Fluffy_Pillow 89.9/120: 75% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:38.127 exsanguinate Fluffy_Pillow 75.8/120: 63% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:39.129 kingsbane Fluffy_Pillow 106.5/120: 89% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:40.133 mutilate Fluffy_Pillow 102.3/120: 85% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:41.137 mutilate Fluffy_Pillow 78.1/120: 65% energy | 3.0/6: 50% combo_points elaborate_planning, potion_of_the_old_war
1:42.142 envenom Fluffy_Pillow 54.0/120: 45% energy | 5.0/6: 83% combo_points potion_of_the_old_war
1:43.146 Waiting 0.400 sec 49.8/120: 41% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:43.546 mutilate Fluffy_Pillow 74.1/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:44.550 Waiting 1.900 sec 49.9/120: 42% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:46.450 garrote Fluffy_Pillow 100.3/120: 84% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:47.454 mutilate Fluffy_Pillow 76.1/120: 63% energy | 4.0/6: 67% combo_points envenom, potion_of_the_old_war
1:48.457 envenom Fluffy_Pillow 51.9/120: 43% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:49.461 Waiting 0.700 sec 37.7/120: 31% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:50.161 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:51.166 Waiting 1.300 sec 31.1/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:52.466 mutilate Fluffy_Pillow 65.1/120: 54% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:53.470 Waiting 1.400 sec 30.9/120: 26% energy | 6.0/6: 100% combo_points envenom, potion_of_the_old_war
1:54.870 rupture Fluffy_Pillow 75.9/120: 63% energy | 6.0/6: 100% combo_points envenom, potion_of_the_old_war
1:55.875 mutilate Fluffy_Pillow 71.7/120: 60% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:56.880 Waiting 0.700 sec 37.6/120: 31% energy | 3.0/6: 50% combo_points elaborate_planning, potion_of_the_old_war
1:57.580 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, potion_of_the_old_war
1:58.587 Waiting 0.479 sec 20.9/120: 17% energy | 6.0/6: 100% combo_points elaborate_planning
1:59.066 rupture Fluffy_Pillow 26.1/120: 22% energy | 6.0/6: 100% combo_points elaborate_planning
2:00.072 Waiting 1.188 sec 21.9/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning
2:01.517 garrote Fluffy_Pillow 57.4/120: 48% energy | 0.0/6: 0% combo_points elaborate_planning
2:02.522 Waiting 1.100 sec 33.3/120: 28% energy | 1.0/6: 17% combo_points elaborate_planning
2:03.622 mutilate Fluffy_Pillow 55.1/120: 46% energy | 1.0/6: 17% combo_points elaborate_planning
2:04.628 Waiting 1.878 sec 20.9/120: 17% energy | 3.0/6: 50% combo_points
2:06.506 mutilate Fluffy_Pillow 61.1/120: 51% energy | 3.0/6: 50% combo_points
2:07.512 Waiting 3.000 sec 27.0/120: 22% energy | 6.0/6: 100% combo_points
2:10.512 envenom Fluffy_Pillow 89.2/120: 74% energy | 6.0/6: 100% combo_points
2:11.517 mutilate Fluffy_Pillow 75.1/120: 63% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
2:12.522 Waiting 1.000 sec 40.9/120: 34% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, sixfeather_fan
2:13.522 mutilate Fluffy_Pillow 61.6/120: 51% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, sixfeather_fan
2:14.526 Waiting 1.800 sec 27.4/120: 23% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, sixfeather_fan
2:16.326 garrote Fluffy_Pillow 56.8/120: 47% energy | 5.0/6: 83% combo_points envenom
2:17.519 Waiting 2.000 sec 44.6/120: 37% energy | 6.0/6: 100% combo_points
2:19.519 envenom Fluffy_Pillow 86.2/120: 72% energy | 6.0/6: 100% combo_points
2:20.522 mutilate Fluffy_Pillow 72.0/120: 60% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:21.528 Waiting 1.000 sec 37.8/120: 31% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:22.528 mutilate Fluffy_Pillow 58.5/120: 49% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:23.533 Waiting 0.100 sec 24.4/120: 20% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:23.633 vanish Fluffy_Pillow 25.4/120: 21% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:23.633 rupture Fluffy_Pillow 25.4/120: 21% energy | 6.0/6: 100% combo_points vanish, envenom, elaborate_planning
2:24.640 exsanguinate Fluffy_Pillow 21.3/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:25.645 kingsbane Fluffy_Pillow 52.1/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:26.649 Waiting 0.500 sec 47.9/120: 40% energy | 0.0/6: 0% combo_points elaborate_planning
2:27.149 mutilate Fluffy_Pillow 63.3/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning
2:28.154 Waiting 0.600 sec 39.1/120: 33% energy | 2.0/6: 33% combo_points elaborate_planning
2:28.754 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points
2:29.759 Waiting 2.600 sec 31.3/120: 26% energy | 4.0/6: 67% combo_points
2:32.359 garrote Fluffy_Pillow 119.3/120: 99% energy | 4.0/6: 67% combo_points sixfeather_fan
2:33.362 envenom Fluffy_Pillow 95.1/120: 79% energy | 5.0/6: 83% combo_points sixfeather_fan
2:34.367 mutilate Fluffy_Pillow 90.9/120: 76% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
2:35.371 mutilate Fluffy_Pillow 56.7/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, sixfeather_fan
2:36.375 Waiting 0.300 sec 32.5/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:36.675 envenom Fluffy_Pillow 35.8/120: 30% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:37.682 Waiting 1.315 sec 21.6/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:38.997 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:40.002 Waiting 1.118 sec 21.6/120: 18% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:41.120 mutilate Fluffy_Pillow 63.6/120: 53% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, sixfeather_fan
2:42.125 Waiting 0.300 sec 29.4/120: 25% energy | 5.0/6: 83% combo_points envenom, sixfeather_fan
2:42.425 rupture Fluffy_Pillow 52.6/120: 44% energy | 5.0/6: 83% combo_points envenom, sixfeather_fan
2:43.430 Waiting 1.000 sec 38.5/120: 32% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
2:44.430 mutilate Fluffy_Pillow 69.2/120: 58% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
2:45.436 Waiting 1.700 sec 25.0/120: 21% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
2:47.136 garrote Fluffy_Pillow 63.3/120: 53% energy | 2.0/6: 33% combo_points elaborate_planning
2:48.363 Waiting 0.400 sec 41.5/120: 35% energy | 3.0/6: 50% combo_points
2:48.763 mutilate Fluffy_Pillow 55.8/120: 47% energy | 3.0/6: 50% combo_points
2:49.768 Waiting 1.239 sec 11.7/120: 10% energy | 5.0/6: 83% combo_points
2:51.007 rupture Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points
2:52.012 Waiting 0.500 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
2:52.512 mutilate Fluffy_Pillow 56.2/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
2:53.517 Waiting 2.208 sec 12.0/120: 10% energy | 3.0/6: 50% combo_points elaborate_planning
2:55.725 mutilate Fluffy_Pillow 55.8/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, infernal_alchemist_stone
2:56.730 Waiting 2.700 sec 31.6/120: 26% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
2:59.430 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points infernal_alchemist_stone, sixfeather_fan
3:00.435 Waiting 1.700 sec 76.4/120: 64% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:02.135 garrote Fluffy_Pillow 94.7/120: 79% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:03.363 mutilate Fluffy_Pillow 82.9/120: 69% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:04.368 Waiting 0.100 sec 48.8/120: 41% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:04.468 mutilate Fluffy_Pillow 59.8/120: 50% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
3:05.473 vendetta Fluffy_Pillow 15.7/120: 13% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
3:05.473 envenom Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
3:06.477 mutilate Fluffy_Pillow 115.8/120: 97% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:07.481 mutilate Fluffy_Pillow 71.6/120: 60% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
3:08.487 Waiting 0.200 sec 47.4/120: 40% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:08.687 rupture Fluffy_Pillow 49.6/120: 41% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:09.693 exsanguinate Fluffy_Pillow 35.4/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:10.696 kingsbane Fluffy_Pillow 66.2/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:11.701 mutilate Fluffy_Pillow 62.0/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:12.705 Waiting 0.400 sec 37.8/120: 32% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:13.105 mutilate Fluffy_Pillow 62.1/120: 52% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:14.110 envenom Fluffy_Pillow 37.9/120: 32% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
3:15.115 Waiting 2.700 sec 33.8/120: 28% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:17.815 garrote Fluffy_Pillow 112.8/120: 94% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:18.820 mutilate Fluffy_Pillow 88.6/120: 74% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:19.824 mutilate Fluffy_Pillow 64.4/120: 54% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone
3:20.829 Waiting 0.300 sec 30.2/120: 25% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
3:21.129 envenom Fluffy_Pillow 43.5/120: 36% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
3:22.135 Waiting 1.000 sec 39.3/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:23.135 mutilate Fluffy_Pillow 60.1/120: 50% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:24.140 Waiting 1.000 sec 35.9/120: 30% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:25.140 mutilate Fluffy_Pillow 56.6/120: 47% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:26.144 Waiting 0.300 sec 32.4/120: 27% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
3:26.444 rupture Fluffy_Pillow 35.7/120: 30% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
3:27.449 Waiting 1.300 sec 31.5/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
3:28.749 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
3:29.754 Waiting 2.845 sec 21.3/120: 18% energy | 2.0/6: 33% combo_points elaborate_planning
3:32.599 garrote Fluffy_Pillow 81.9/120: 68% energy | 2.0/6: 33% combo_points
3:33.819 mutilate Fluffy_Pillow 70.0/120: 58% energy | 3.0/6: 50% combo_points
3:34.823 Waiting 0.100 sec 25.8/120: 22% energy | 5.0/6: 83% combo_points
3:34.923 rupture Fluffy_Pillow 26.9/120: 22% energy | 5.0/6: 83% combo_points
3:35.927 Waiting 1.200 sec 32.7/120: 27% energy | 0.0/6: 0% combo_points elaborate_planning
3:37.127 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
3:38.131 Waiting 1.732 sec 21.4/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning
3:39.863 mutilate Fluffy_Pillow 60.1/120: 50% energy | 3.0/6: 50% combo_points elaborate_planning
3:40.868 Waiting 2.948 sec 15.9/120: 13% energy | 6.0/6: 100% combo_points
3:43.816 envenom Fluffy_Pillow 87.6/120: 73% energy | 6.0/6: 100% combo_points
3:44.820 mutilate Fluffy_Pillow 63.4/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:45.824 Waiting 1.800 sec 39.2/120: 33% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:47.624 garrote Fluffy_Pillow 68.6/120: 57% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:48.819 Waiting 0.300 sec 46.4/120: 39% energy | 4.0/6: 67% combo_points envenom
3:49.119 mutilate Fluffy_Pillow 59.7/120: 50% energy | 4.0/6: 67% combo_points envenom
3:50.124 Waiting 3.300 sec 25.5/120: 21% energy | 6.0/6: 100% combo_points envenom
3:53.424 mutilate Fluffy_Pillow 91.0/120: 76% energy | 6.0/6: 100% combo_points
3:54.428 rupture Fluffy_Pillow 56.8/120: 47% energy | 6.0/6: 100% combo_points
3:55.433 exsanguinate Fluffy_Pillow 52.6/120: 44% energy | 0.0/6: 0% combo_points elaborate_planning
3:56.436 kingsbane Fluffy_Pillow 83.4/120: 69% energy | 0.0/6: 0% combo_points elaborate_planning
3:57.441 mutilate Fluffy_Pillow 79.2/120: 66% energy | 0.0/6: 0% combo_points elaborate_planning
3:58.446 mutilate Fluffy_Pillow 55.0/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
3:59.450 Waiting 0.200 sec 30.8/120: 26% energy | 6.0/6: 100% combo_points
3:59.650 envenom Fluffy_Pillow 43.0/120: 36% energy | 6.0/6: 100% combo_points
4:00.655 Waiting 2.700 sec 38.8/120: 32% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:03.355 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:04.360 mutilate Fluffy_Pillow 95.8/120: 80% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:05.365 mutilate Fluffy_Pillow 71.6/120: 60% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone
4:06.371 envenom Fluffy_Pillow 37.5/120: 31% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
4:07.376 Waiting 1.100 sec 33.3/120: 28% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:08.476 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:09.480 Waiting 1.400 sec 30.9/120: 26% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:10.880 mutilate Fluffy_Pillow 56.0/120: 47% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:11.884 Waiting 0.300 sec 31.8/120: 26% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
4:12.184 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
4:13.189 Waiting 1.100 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
4:14.289 mutilate Fluffy_Pillow 62.7/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
4:15.293 Waiting 2.907 sec 18.5/120: 15% energy | 3.0/6: 50% combo_points elaborate_planning, infernal_alchemist_stone
4:18.200 garrote Fluffy_Pillow 79.7/120: 66% energy | 3.0/6: 50% combo_points infernal_alchemist_stone
4:19.359 mutilate Fluffy_Pillow 67.2/120: 56% energy | 4.0/6: 67% combo_points
4:20.363 rupture Fluffy_Pillow 33.0/120: 28% energy | 6.0/6: 100% combo_points
4:21.368 Waiting 1.600 sec 28.8/120: 24% energy | 0.0/6: 0% combo_points elaborate_planning
4:22.968 mutilate Fluffy_Pillow 56.0/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
4:23.972 Waiting 1.392 sec 21.9/120: 18% energy | 2.0/6: 33% combo_points elaborate_planning
4:25.364 mutilate Fluffy_Pillow 56.8/120: 47% energy | 2.0/6: 33% combo_points
4:26.367 Waiting 3.020 sec 22.6/120: 19% energy | 5.0/6: 83% combo_points
4:29.387 envenom Fluffy_Pillow 85.1/120: 71% energy | 5.0/6: 83% combo_points
4:30.392 mutilate Fluffy_Pillow 70.9/120: 59% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:31.396 Waiting 1.800 sec 36.7/120: 31% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:33.196 garrote Fluffy_Pillow 66.1/120: 55% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:34.360 Waiting 0.200 sec 53.6/120: 45% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
4:34.560 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points envenom
4:35.564 vendetta Fluffy_Pillow 21.6/120: 18% energy | 6.0/6: 100% combo_points
4:35.564 envenom Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points
4:36.570 mutilate Fluffy_Pillow 105.8/120: 88% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:37.575 mutilate Fluffy_Pillow 71.6/120: 60% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:38.580 Waiting 0.900 sec 37.5/120: 31% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
4:39.480 vanish Fluffy_Pillow 57.1/120: 48% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
4:39.480 rupture Fluffy_Pillow 57.1/120: 48% energy | 6.0/6: 100% combo_points vanish, envenom, elaborate_planning
4:40.483 exsanguinate Fluffy_Pillow 52.9/120: 44% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:41.488 kingsbane Fluffy_Pillow 83.7/120: 70% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:42.493 mutilate Fluffy_Pillow 79.6/120: 66% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:43.498 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
4:44.504 Waiting 0.400 sec 31.2/120: 26% energy | 6.0/6: 100% combo_points
4:44.904 envenom Fluffy_Pillow 35.5/120: 30% energy | 6.0/6: 100% combo_points
4:45.909 Waiting 2.800 sec 31.3/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:48.709 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:49.713 mutilate Fluffy_Pillow 95.8/120: 80% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:50.718 mutilate Fluffy_Pillow 71.6/120: 60% energy | 4.0/6: 67% combo_points envenom
4:51.721 envenom Fluffy_Pillow 37.4/120: 31% energy | 6.0/6: 100% combo_points envenom
4:52.727 Waiting 1.100 sec 33.2/120: 28% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:53.827 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:54.834 Waiting 1.400 sec 30.9/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:56.234 mutilate Fluffy_Pillow 56.0/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:57.238 Waiting 1.000 sec 31.8/120: 26% energy | 4.0/6: 67% combo_points envenom
4:58.238 rupture Fluffy_Pillow 62.5/120: 52% energy | 4.0/6: 67% combo_points envenom
4:59.243 mutilate Fluffy_Pillow 58.4/120: 49% energy | 0.0/6: 0% combo_points elaborate_planning
5:00.247 Waiting 3.300 sec 24.2/120: 20% energy | 2.0/6: 33% combo_points elaborate_planning
5:03.547 garrote Fluffy_Pillow 89.7/120: 75% energy | 2.0/6: 33% combo_points
5:04.713 mutilate Fluffy_Pillow 77.2/120: 64% energy | 3.0/6: 50% combo_points
5:05.716 rupture Fluffy_Pillow 33.0/120: 28% energy | 5.0/6: 83% combo_points
5:06.722 Waiting 1.600 sec 38.8/120: 32% energy | 0.0/6: 0% combo_points elaborate_planning
5:08.322 mutilate Fluffy_Pillow 66.0/120: 55% energy | 0.0/6: 0% combo_points elaborate_planning
5:09.325 Waiting 1.300 sec 31.8/120: 27% energy | 2.0/6: 33% combo_points elaborate_planning
5:10.625 mutilate Fluffy_Pillow 55.8/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning, sixfeather_fan
5:11.630 Waiting 1.311 sec 21.6/120: 18% energy | 4.0/6: 67% combo_points sixfeather_fan
5:12.941 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points sixfeather_fan
5:13.945 Waiting 2.849 sec 11.6/120: 10% energy | 6.0/6: 100% combo_points sixfeather_fan
5:16.794 envenom Fluffy_Pillow 82.2/120: 69% energy | 6.0/6: 100% combo_points
5:17.797 Waiting 0.700 sec 58.0/120: 48% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:18.497 garrote Fluffy_Pillow 75.5/120: 63% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, sixfeather_fan
5:19.712 Waiting 0.200 sec 53.6/120: 45% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan
5:19.912 mutilate Fluffy_Pillow 55.8/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, sixfeather_fan
5:20.916 Waiting 1.400 sec 31.6/120: 26% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, sixfeather_fan
5:22.316 mutilate Fluffy_Pillow 56.6/120: 47% energy | 4.0/6: 67% combo_points envenom, sixfeather_fan
5:23.322 Waiting 1.236 sec 22.5/120: 19% energy | 6.0/6: 100% combo_points envenom
5:24.558 rupture Fluffy_Pillow 45.8/120: 38% energy | 6.0/6: 100% combo_points
5:25.564 exsanguinate Fluffy_Pillow 41.6/120: 35% energy | 0.0/6: 0% combo_points elaborate_planning
5:26.570 kingsbane Fluffy_Pillow 72.4/120: 60% energy | 0.0/6: 0% combo_points elaborate_planning
5:27.575 mutilate Fluffy_Pillow 68.2/120: 57% energy | 0.0/6: 0% combo_points elaborate_planning
5:28.579 Waiting 0.400 sec 44.0/120: 37% energy | 3.0/6: 50% combo_points elaborate_planning
5:28.979 mutilate Fluffy_Pillow 58.3/120: 49% energy | 3.0/6: 50% combo_points elaborate_planning
5:29.984 Waiting 0.100 sec 34.1/120: 28% energy | 6.0/6: 100% combo_points
5:30.084 envenom Fluffy_Pillow 35.2/120: 29% energy | 6.0/6: 100% combo_points
5:31.089 Waiting 2.800 sec 31.0/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:33.889 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:34.893 mutilate Fluffy_Pillow 95.8/120: 80% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
5:35.897 mutilate Fluffy_Pillow 71.6/120: 60% energy | 4.0/6: 67% combo_points envenom
5:36.903 envenom Fluffy_Pillow 47.4/120: 40% energy | 6.0/6: 100% combo_points envenom
5:37.907 Waiting 1.000 sec 43.2/120: 36% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:38.907 mutilate Fluffy_Pillow 64.0/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:39.910 Waiting 1.000 sec 39.8/120: 33% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
5:40.910 mutilate Fluffy_Pillow 60.6/120: 50% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
5:41.915 Waiting 0.400 sec 36.4/120: 30% energy | 6.0/6: 100% combo_points envenom
5:42.315 rupture Fluffy_Pillow 40.7/120: 34% energy | 6.0/6: 100% combo_points envenom
5:43.320 Waiting 0.800 sec 36.5/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:44.120 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
5:45.125 Waiting 3.580 sec 20.9/120: 17% energy | 2.0/6: 33% combo_points elaborate_planning
5:48.705 garrote Fluffy_Pillow 89.4/120: 75% energy | 2.0/6: 33% combo_points
5:49.893 mutilate Fluffy_Pillow 77.2/120: 64% energy | 3.0/6: 50% combo_points
5:50.897 rupture Fluffy_Pillow 33.0/120: 28% energy | 5.0/6: 83% combo_points
5:51.902 Waiting 1.000 sec 38.8/120: 32% energy | 0.0/6: 0% combo_points elaborate_planning
5:52.902 mutilate Fluffy_Pillow 59.6/120: 50% energy | 0.0/6: 0% combo_points elaborate_planning
5:53.905 Waiting 1.900 sec 25.4/120: 21% energy | 3.0/6: 50% combo_points elaborate_planning
5:55.805 mutilate Fluffy_Pillow 55.8/120: 47% energy | 3.0/6: 50% combo_points elaborate_planning
5:56.810 Waiting 2.711 sec 21.6/120: 18% energy | 5.0/6: 83% combo_points
5:59.521 envenom Fluffy_Pillow 80.8/120: 67% energy | 5.0/6: 83% combo_points
6:00.527 mutilate Fluffy_Pillow 66.6/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:01.531 Waiting 2.200 sec 32.4/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
6:03.731 garrote Fluffy_Pillow 76.1/120: 63% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
6:04.893 Waiting 0.100 sec 53.6/120: 45% energy | 4.0/6: 67% combo_points envenom
6:04.993 mutilate Fluffy_Pillow 64.7/120: 54% energy | 4.0/6: 67% combo_points envenom
6:05.999 vendetta Fluffy_Pillow 30.5/120: 25% energy | 6.0/6: 100% combo_points
6:05.999 envenom Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points
6:07.004 mutilate Fluffy_Pillow 105.8/120: 88% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:08.009 mutilate Fluffy_Pillow 71.6/120: 60% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:09.016 Waiting 0.600 sec 37.5/120: 31% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
6:09.616 rupture Fluffy_Pillow 43.9/120: 37% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
6:10.621 exsanguinate Fluffy_Pillow 39.7/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:11.626 kingsbane Fluffy_Pillow 70.5/120: 59% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:12.631 mutilate Fluffy_Pillow 66.4/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:13.634 Waiting 0.300 sec 42.2/120: 35% energy | 3.0/6: 50% combo_points elaborate_planning
6:13.934 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
6:14.940 Waiting 0.400 sec 31.2/120: 26% energy | 5.0/6: 83% combo_points
6:15.340 envenom Fluffy_Pillow 45.5/120: 38% energy | 5.0/6: 83% combo_points
6:16.345 Waiting 0.500 sec 41.3/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:16.845 mutilate Fluffy_Pillow 56.7/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:17.850 Waiting 1.200 sec 32.5/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:19.050 garrote Fluffy_Pillow 75.4/120: 63% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
6:20.053 Waiting 0.400 sec 51.2/120: 43% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
6:20.453 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points envenom
6:21.458 Waiting 0.400 sec 31.3/120: 26% energy | 5.0/6: 83% combo_points
6:21.858 envenom Fluffy_Pillow 45.7/120: 38% energy | 5.0/6: 83% combo_points
6:22.861 Waiting 0.900 sec 31.4/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:23.761 mutilate Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
6:24.765 Waiting 1.000 sec 26.9/120: 22% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
6:25.765 mutilate Fluffy_Pillow 57.7/120: 48% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, sixfeather_fan
6:26.769 Waiting 0.639 sec 23.5/120: 20% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, sixfeather_fan
6:27.408 rupture Fluffy_Pillow 40.4/120: 34% energy | 6.0/6: 100% combo_points envenom, sixfeather_fan
6:28.412 Waiting 0.900 sec 36.2/120: 30% energy | 0.0/6: 0% combo_points elaborate_planning, sixfeather_fan
6:29.312 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, sixfeather_fan
6:30.317 Waiting 1.508 sec 21.7/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning
6:31.825 mutilate Fluffy_Pillow 57.9/120: 48% energy | 3.0/6: 50% combo_points elaborate_planning
6:32.829 Waiting 1.049 sec 13.7/120: 11% energy | 5.0/6: 83% combo_points
6:34.132 garrote Fluffy_Pillow 47.7/120: 40% energy | 5.0/6: 83% combo_points sixfeather_fan
6:35.136 Waiting 0.236 sec 23.5/120: 20% energy | 6.0/6: 100% combo_points sixfeather_fan
6:35.372 rupture Fluffy_Pillow 26.1/120: 22% energy | 6.0/6: 100% combo_points sixfeather_fan
6:36.375 Waiting 1.391 sec 21.9/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning, sixfeather_fan
6:37.766 mutilate Fluffy_Pillow 56.8/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone, sixfeather_fan
6:38.769 Waiting 2.149 sec 12.6/120: 11% energy | 2.0/6: 33% combo_points elaborate_planning, infernal_alchemist_stone
6:40.918 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points infernal_alchemist_stone
6:41.923 Waiting 1.300 sec 31.6/120: 26% energy | 4.0/6: 67% combo_points infernal_alchemist_stone
6:43.223 mutilate Fluffy_Pillow 55.6/120: 46% energy | 4.0/6: 67% combo_points infernal_alchemist_stone
6:44.228 Waiting 2.837 sec 21.4/120: 18% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
6:47.065 envenom Fluffy_Pillow 81.9/120: 68% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
6:48.071 Waiting 0.900 sec 67.7/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
6:48.971 garrote Fluffy_Pillow 77.4/120: 65% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
6:50.137 mutilate Fluffy_Pillow 65.0/120: 54% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
6:51.142 Waiting 1.400 sec 30.8/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, infernal_alchemist_stone
6:52.542 mutilate Fluffy_Pillow 55.8/120: 47% energy | 3.0/6: 50% combo_points envenom, infernal_alchemist_stone
6:53.545 Waiting 3.513 sec 21.6/120: 18% energy | 5.0/6: 83% combo_points envenom, infernal_alchemist_stone
6:57.058 mutilate Fluffy_Pillow 99.4/120: 83% energy | 5.0/6: 83% combo_points
6:58.062 vanish Fluffy_Pillow 65.2/120: 54% energy | 6.0/6: 100% combo_points
6:58.062 rupture Fluffy_Pillow 65.2/120: 54% energy | 6.0/6: 100% combo_points vanish
6:59.067 exsanguinate Fluffy_Pillow 61.0/120: 51% energy | 0.0/6: 0% combo_points elaborate_planning
7:00.070 kingsbane Fluffy_Pillow 91.8/120: 77% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
7:01.075 mutilate Fluffy_Pillow 87.7/120: 73% energy | 0.0/6: 0% combo_points elaborate_planning, infernal_alchemist_stone
7:02.079 mutilate Fluffy_Pillow 63.5/120: 53% energy | 4.0/6: 67% combo_points elaborate_planning, infernal_alchemist_stone
7:03.083 envenom Fluffy_Pillow 39.3/120: 33% energy | 6.0/6: 100% combo_points infernal_alchemist_stone
7:04.088 Waiting 1.800 sec 35.1/120: 29% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
7:05.888 garrote Fluffy_Pillow 94.4/120: 79% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone
7:06.892 mutilate Fluffy_Pillow 70.2/120: 59% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, infernal_alchemist_stone
7:07.899 Waiting 0.600 sec 46.1/120: 38% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
7:08.499 mutilate Fluffy_Pillow 62.5/120: 52% energy | 4.0/6: 67% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
7:09.503 Waiting 0.400 sec 28.3/120: 24% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
7:09.903 envenom Fluffy_Pillow 42.6/120: 36% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone, sixfeather_fan
7:10.907 Waiting 1.000 sec 28.5/120: 24% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
7:11.907 mutilate Fluffy_Pillow 59.2/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, infernal_alchemist_stone, sixfeather_fan
7:12.911 Waiting 1.000 sec 25.0/120: 21% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
7:13.911 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, infernal_alchemist_stone
7:14.914 Waiting 0.918 sec 21.6/120: 18% energy | 6.0/6: 100% combo_points envenom, infernal_alchemist_stone
7:15.832 rupture Fluffy_Pillow 41.4/120: 35% energy | 6.0/6: 100% combo_points envenom
7:16.837 Waiting 0.800 sec 47.3/120: 39% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:17.637 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
7:18.640 Waiting 2.000 sec 31.7/120: 26% energy | 4.0/6: 67% combo_points elaborate_planning
7:20.640 garrote Fluffy_Pillow 73.2/120: 61% energy | 4.0/6: 67% combo_points elaborate_planning
7:21.895 Waiting 1.800 sec 51.7/120: 43% energy | 5.0/6: 83% combo_points
7:23.695 envenom Fluffy_Pillow 81.1/120: 68% energy | 5.0/6: 83% combo_points
7:24.700 mutilate Fluffy_Pillow 76.9/120: 64% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:25.706 Waiting 0.800 sec 32.7/120: 27% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
7:26.506 mutilate Fluffy_Pillow 61.3/120: 51% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
7:27.512 Waiting 0.731 sec 17.1/120: 14% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
7:28.243 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
7:29.248 Waiting 1.200 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
7:30.448 mutilate Fluffy_Pillow 63.7/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning
7:31.453 Waiting 1.407 sec 19.5/120: 16% energy | 2.0/6: 33% combo_points elaborate_planning

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8806 8481 0
Agility 23610 21904 11832 (9221)
Stamina 30030 30030 19030
Intellect 5325 5000 0
Spirit 0 0 0
Health 1801800 1801800 0
Energy 120 120 0
Combo Points 6 6 0
Crit 36.04% 36.04% 7363
Haste 7.61% 7.61% 2472
Damage / Heal Versatility 12.17% 11.22% 4486
Attack Power 23610 21904 0
Mastery 69.76% 69.76% 3303
Armor 2016 2016 2016
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 851.00
Local Head Mask of Multitudinous Eyes
ilevel: 870, stats: { 286 Armor, +2344 Sta, +1563 AgiInt, +1005 Crit, +401 Vers, +892 unknown }
Local Neck Vindictive Combatant's Choker
ilevel: 840, stats: { +997 Sta, +960 Vers, +808 Mastery }
Local Shoulders Dreadhide Mantle
ilevel: 835, stats: { 235 Armor, +846 AgiInt, +1269 Sta, +542 Crit, +384 Haste }
Local Chest Biornskin Vest
ilevel: 850, stats: { 329 Armor, +1297 AgiInt, +1945 Sta, +848 Crit, +456 Mastery }, gems: { +150 Vers }
Local Waist Sinister Ashfall Cord
ilevel: 845, stats: { 182 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Mastery }
Local Legs Dreadhide Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +764 Crit, +540 Haste }
Local Feet Shadow Stalker Boots
ilevel: 850, stats: { 226 Armor, +973 AgiInt, +1459 Sta, +574 Vers, +406 Haste }
Local Wrists Thermal Bindings
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +475 Mastery, +232 Crit }
Local Hands Rivermane Gloves
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +592 Haste, +350 Crit, +506 unknown }
Local Finger1 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Mastery }, enchant: { +150 Vers }
Local Finger2 Vindictive Combatant's Ring
ilevel: 845, stats: { +1045 Sta, +1081 Vers, +721 Crit }, enchant: { +150 Vers }
Local Trinket1 Infernal Alchemist Stone
ilevel: 850, stats: { +932 Vers }
Local Trinket2 Six-Feather Fan
ilevel: 850, stats: { +1233 Agi }
Local Back Evergreen Vinewrap Drape
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +502 Haste, +245 Crit }
Local Main Hand The Kingslayers
ilevel: 873, weapon: { 2826 - 5251, 1.8 }, stats: { +689 Agi, +1033 Sta, +310 Crit, +298 Mastery }, relics: { +40 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand The Kingslayers
ilevel: 873, weapon: { 2826 - 5251, 1.8 }, stats: { +689 Agi, +1033 Sta, +310 Crit, +298 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Ptitfille"
origin="https://eu.api.battle.net/wow/character/hyjal/Ptitfille/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/206/115091406-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=alchemy=784/herbalism=800
talents=http://eu.battle.net/wow/en/tool/talent-calculator#ca!1002020
artifact=43:0:0:0:0:323:3:325:3:328:3:330:3:331:3:332:1:337:1:346:1:347:1:1276:1
spec=assassination

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=combo_points>=2&!ticking&time<10&!artifact.urge_to_kill.enabled&talent.exsanguinate.enabled
actions+=/rupture,if=combo_points>=4&!ticking&talent.exsanguinate.enabled
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=!talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>10)|talent.exsanguinate.enabled&dot.rupture.exsanguinated
actions+=/run_action_list,name=exsang_combo,if=cooldown.exsanguinate.remains<3&talent.exsanguinate.enabled&(buff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

# Builders Exsanguinate
actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=equipped.the_dreadlords_deceit&((buff.the_dreadlords_deceit.stack>=29|buff.the_dreadlords_deceit.stack>=15&debuff.vendetta.remains<=3)&debuff.vendetta.up|buff.the_dreadlords_deceit.stack>=5&cooldown.vendetta.remains>60&cooldown.vendetta.remains<65)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&(dot.rupture.exsanguinated&dot.rupture.remains<=2|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

# Builders no Exsanguinate
actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=equipped.the_dreadlords_deceit&((buff.the_dreadlords_deceit.stack>=29|buff.the_dreadlords_deceit.stack>=15&debuff.vendetta.remains<=3)&debuff.vendetta.up|buff.the_dreadlords_deceit.stack>=5&cooldown.vendetta.remains>60&cooldown.vendetta.remains<65)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

# Cooldowns
actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=artifact.urge_to_kill.enabled&dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<5)&(energy<55|time<10|spell_targets.fan_of_knives>=2)
actions.cds+=/vendetta,if=!artifact.urge_to_kill.enabled&dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1)
actions.cds+=/vanish,if=talent.subterfuge.enabled&combo_points<=2&!dot.rupture.exsanguinated|talent.shadow_focus.enabled&!dot.rupture.exsanguinated&combo_points.deficit>=2
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=5+talent.deeper_stratagem.enabled&energy>=25&gcd.remains=0

# Exsanguinated Finishers
actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|dot.rupture.remains>2&spell_targets.fan_of_knives>=3)&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

# Exsanguinate Combo
actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)&cooldown.exsanguinate.remains<1
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

# Finishers Exsanguinate
actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

# Finishers no Exsanguinate
actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&(((dot.rupture.refreshable)|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=(combo_points>=5+talent.deeper_stratagem.enabled-2*talent.elaborate_planning.enabled)&variable.envenom_condition&(refreshable|talent.elaborate_planning.enabled&!buff.elaborate_planning.up|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=(combo_points>=5+talent.deeper_stratagem.enabled-2*talent.elaborate_planning.enabled)&variable.envenom_condition&(refreshable|talent.elaborate_planning.enabled&!buff.elaborate_planning.up|cooldown.garrote.remains<1)

# Garrote
actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1807/43/1492/3337
neck=vindictive_combatants_choker,id=135915,bonus_id=3428/1502/1813
shoulders=dreadhide_mantle,id=121298,bonus_id=3432/1497/1674
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1477/3336
chest=biornskin_vest,id=134197,bonus_id=1727/1808/1512/3336,gems=150vers
wrists=thermal_bindings,id=134461,bonus_id=1727/1492/1813
hands=rivermane_gloves,id=139107,bonus_id=3396/43/1502/3337
waist=sinister_ashfall_cord,id=134455,bonus_id=1727/1497/3336
legs=dreadhide_leggings,id=121294,bonus_id=3432/1512/3337
feet=shadow_stalker_boots,id=136739,bonus_id=1727/1512/3336
finger1=roughhammered_silver_ring,id=134191,bonus_id=3397/1512/3337,enchant=150vers
finger2=vindictive_combatants_ring,id=135908,bonus_id=3428/1507/3336,enchant=150vers
trinket1=infernal_alchemist_stone,id=127842,bonus_id=689/600/669
trinket2=sixfeather_fan,id=141585,bonus_id=1512/3336
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=137377/133763/137350/0,relic_id=1727:1492:1813/1727:1502:3336/1727:1492:1813/0
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=851.00
# gear_agility=11832
# gear_stamina=19030
# gear_crit_rating=7219
# gear_haste_rating=2424
# gear_mastery_rating=3238
# gear_versatility_rating=4398
# gear_armor=2016

Oshamëren

Oshamëren : 171625 dps

  • Race: Pandaren Alliance
  • Class: Shaman
  • Spec: Elemental
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
171624.5 171624.5 89.8 / 0.052% 17921.9 / 10.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 46.6 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Oshamëren/advanced
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Elemental Mastery (Elemental Shaman)
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact
Professions
  • alchemy: 741
  • herbalism: 796

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oshamëren 171625
Deadly Grace 6395 3.7% 28.6 7.61sec 98981 0 Direct 28.6 82182 164363 98983 20.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.64 28.64 0.00 0.00 0.0000 0.0000 2834578.02 2834578.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.78 79.56% 82181.57 82182 82182 82181.57 82182 82182 1872382 1872382 0.00
crit 5.85 20.44% 164363.15 164363 164363 163985.07 0 164363 962196 962196 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Earth Shock 22394 13.1% 37.8 11.81sec 267041 249234 Direct 37.8 204481 511195 267042 20.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.76 37.76 0.00 0.00 1.0715 0.0000 10083769.37 10083769.37 0.00 249234.27 249234.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.06 79.60% 204480.91 176008 225126 204502.92 193865 213313 6146492 6146492 0.00
crit 7.70 20.40% 511195.32 440020 562816 511053.79 0 562816 3937277 3937277 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:90.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 15095 8.8% 14.3 32.37sec 474256 447088 Direct 14.3 27521 68787 36032 20.6%  
Periodic 316.1 15205 38011 19874 20.5% 99.5%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 316.09 316.09 1.0608 1.4187 6798426.02 6798426.02 0.00 14662.94 447088.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.38 79.37% 27520.81 25379 27917 27517.15 26467 27917 313125 313125 0.00
crit 2.96 20.63% 68786.52 63448 69793 66065.16 0 69793 203413 203413 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 251.4 79.53% 15204.53 10 15355 15203.75 14783 15355 3821982 3821982 0.00
crit 64.7 20.47% 38010.55 25 38388 38008.92 36519 38388 2459906 2459906 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning=3&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}. Maelstrom increases duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 38759 (47695) 22.5% (27.7%) 88.0 5.11sec 243537 196031 Direct 87.8 0 198231 198231 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.98 87.84 0.00 0.00 1.2423 0.0000 17412519.35 17412519.35 0.00 196031.30 196031.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 87.84 100.00% 198230.81 172720 228930 198288.71 193354 203711 17412519 17412519 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lava_surge.up&spell_targets.chain_lightning=3
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 8936 5.2% 27.9 15.87sec 144034 0 Direct 27.8 0 144356 144356 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.87 27.81 0.00 0.00 0.0000 0.0000 4014289.98 4014289.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 27.81 100.00% 144356.41 125758 166684 144399.14 132604 158195 4014290 4014290 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Bolt 34000 (49292) 19.8% (28.8%) 187.9 2.38sec 118265 81676 Direct 187.9 62458 155922 81588 20.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.85 187.85 0.00 0.00 1.4480 0.0000 15326322.76 15326322.76 0.00 81676.18 81676.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.41 79.53% 62458.40 47073 155341 62468.12 54906 67326 9331814 9331814 0.00
crit 38.44 20.47% 155922.02 117683 388353 155892.63 122799 227773 5994509 5994509 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage. |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 15292 8.9% 107.5 4.64sec 64071 0 Direct 107.5 48993 122551 64070 20.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.54 107.54 0.00 0.00 0.0000 0.0000 6890005.31 6890005.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.50 79.50% 48993.30 35305 116506 49002.55 38533 60349 4188702 4188702 0.00
crit 22.04 20.50% 122551.23 88262 291265 122528.39 90858 201041 2701304 2701304 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 4378 2.6% 24.1 18.67sec 81673 0 Periodic 116.1 16987 0 16987 0.0% 6.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.14 0.00 120.47 116.06 0.0000 0.2500 1971533.55 1971533.55 0.00 65473.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.1 100.00% 16987.15 136 16990 16987.21 16690 16990 1971534 1971534 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.7500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
pet - primal_fire_elemental 81261 / 26375
Fire Blast 70365 13.4% 68.9 5.66sec 149794 76166 Direct 68.9 124331 248662 149794 20.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.87 68.87 0.00 0.00 1.9667 0.0000 10315558.95 10315558.95 0.00 76165.56 76165.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.76 79.52% 124331.18 124331 124331 124331.18 124331 124331 6808596 6808596 0.00
crit 14.10 20.48% 248662.37 248662 248662 248662.37 248662 248662 3506963 3506963 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 10896 2.1% 7.4 58.82sec 215291 150316 Direct 7.4 36839 73678 44314 20.3%  
Periodic 80.7 13064 26131 15736 20.4% 33.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.43 7.43 80.68 80.68 1.4323 1.8869 1598756.84 1598756.84 0.00 9815.37 150315.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.92 79.71% 36838.87 36839 36839 36835.18 0 36839 218053 218053 0.00
crit 1.51 20.29% 73677.74 73678 73678 59088.09 0 73678 111029 111029 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.2 79.55% 13064.09 1003 13815 13067.68 12621 13789 838520 838520 0.00
crit 16.5 20.45% 26131.24 2006 27629 26131.21 19824 27629 431155 431155 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Oshamëren
Ascendance 2.9 180.80sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oshamëren
  • harmful:false
  • if_expr:
 
Elemental Mastery 4.3 120.48sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
 
Fire Elemental 2.6 223.49sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.60 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oshamëren
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 7.5 65.02sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.51 0.00 0.00 0.00 0.9676 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to deal {$s1=200}% increased damage.
 
Totem Mastery 4.5 111.24sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.53 0.00 0.00 0.00 0.5935 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.9 0.0 180.8sec 180.8sec 9.67% 34.68% 0.0(0.0) 2.8

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.66% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elemental Focus 87.8 52.8 5.1sec 3.2sec 71.32% 54.74% 52.8(52.9) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.63%
  • elemental_focus_2:51.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Mastery 4.3 0.0 120.5sec 120.5sec 18.61% 22.62% 0.0(0.0) 4.1

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.83

Stack Uptimes

  • elemental_mastery_1:18.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Ember Totem 1.0 3.5 0.0sec 111.2sec 100.00% 99.81% 3.5(3.5) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 30.5 1.1 14.4sec 13.9sec 8.34% 29.48% 1.1(1.1) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.34%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 187.9sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power of the Maelstrom 9.7 3.4 45.4sec 32.7sec 19.60% 14.79% 3.4(9.6) 0.2

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:4.07%
  • power_of_the_maelstrom_2:4.16%
  • power_of_the_maelstrom_3:11.36%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 3.5 0.0sec 111.2sec 100.00% 100.00% 452.0(452.0) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 3.5 0.0sec 111.2sec 100.00% 99.46% 3.5(3.5) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 7.5 0.0 64.4sec 65.0sec 11.32% 11.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.14%
  • stormkeeper_2:3.17%
  • stormkeeper_3:5.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 3.5 0.0sec 111.2sec 100.00% 99.80% 3.5(3.5) 0.0

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Oshamëren
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6920.00132.52028.6742.50042.463
Fire Elemental0.3070.0011.1440.1380.0002.285
Elemental Mastery0.5590.0011.2711.5690.0004.569
Ascendance0.9540.0017.2171.5870.00010.440
Lava Burst0.9800.0016.06349.69625.22191.669

Resources

Resource Usage Type Count Total Average RPE APR
Oshamëren
earth_shock Maelstrom 37.8 3556.2 94.2 94.2 2835.6
flame_shock Maelstrom 14.3 267.1 18.6 18.6 25448.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 87.98 1036.59 (26.83%) 11.78 19.19 1.82%
Lava Burst Overload Maelstrom 27.87 240.56 (6.23%) 8.63 10.26 4.09%
Lightning Bolt Maelstrom 187.85 1499.84 (38.82%) 7.98 2.97 0.20%
Lightning Bolt Overload Maelstrom 107.54 640.23 (16.57%) 5.95 4.99 0.77%
Resonance Totem Maelstrom 448.47 445.99 (11.54%) 0.99 2.49 0.55%
Resource RPS-Gain RPS-Loss
Maelstrom 8.57 8.49
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 39.27 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Lava Surge 31.6 13.9sec
Lava Surge: Wasted 1.2 123.6sec
Lava Surge: During Lava Burst 5.8 68.8sec

Statistics & Data Analysis

Fight Length
Sample Data Oshamëren Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Oshamëren Damage Per Second
Count 9999
Mean 171624.55
Minimum 155318.17
Maximum 189804.94
Spread ( max - min ) 34486.77
Range [ ( max - min ) / 2 * 100% ] 10.05%
Standard Deviation 4581.1572
5th Percentile 164361.27
95th Percentile 179394.43
( 95th Percentile - 5th Percentile ) 15033.15
Mean Distribution
Standard Deviation 45.8139
95.00% Confidence Intervall ( 171534.75 - 171714.34 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2737
0.1 Scale Factor Error with Delta=300 179157
0.05 Scale Factor Error with Delta=300 716628
0.01 Scale Factor Error with Delta=300 17915711
Priority Target DPS
Sample Data Oshamëren Priority Target Damage Per Second
Count 9999
Mean 171624.55
Minimum 155318.17
Maximum 189804.94
Spread ( max - min ) 34486.77
Range [ ( max - min ) / 2 * 100% ] 10.05%
Standard Deviation 4581.1572
5th Percentile 164361.27
95th Percentile 179394.43
( 95th Percentile - 5th Percentile ) 15033.15
Mean Distribution
Standard Deviation 45.8139
95.00% Confidence Intervall ( 171534.75 - 171714.34 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2737
0.1 Scale Factor Error with Delta=300 179157
0.05 Scale Factor Error with Delta=300 716628
0.01 Scale Factor Error with Delta=300 17915711
DPS(e)
Sample Data Oshamëren Damage Per Second (Effective)
Count 9999
Mean 171624.55
Minimum 155318.17
Maximum 189804.94
Spread ( max - min ) 34486.77
Range [ ( max - min ) / 2 * 100% ] 10.05%
Damage
Sample Data Oshamëren Damage
Count 9999
Mean 65331444.36
Minimum 46852968.35
Maximum 83882258.19
Spread ( max - min ) 37029289.84
Range [ ( max - min ) / 2 * 100% ] 28.34%
DTPS
Sample Data Oshamëren Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oshamëren Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oshamëren Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oshamëren Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oshamëren Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oshamëren Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OshamërenTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oshamëren Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 stormkeeper
6 0.00 totem_mastery
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
0.00 totem_mastery,if=buff.resonance_totem.remains<2
8 2.60 fire_elemental
0.00 storm_elemental
9 4.30 elemental_mastery
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single
actions.single Single target action priority list
# count action,conditions
C 2.94 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
D 1.44 flame_shock,if=!ticking
E 3.01 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
F 26.08 earth_shock,if=maelstrom>=92
0.00 icefury,if=raid_event.movement.in<5
G 88.16 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
0.00 elemental_blast
0.00 earthquake_totem,if=buff.echoes_of_the_great_sundering.up
H 9.89 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
0.00 frost_shock,moving=1,if=buff.icefury.up
I 11.68 earth_shock,if=maelstrom>=86
0.00 icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.51 stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
K 3.53 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
L 29.44 lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
0.00 lightning_bolt,if=buff.power_of_the_maelstrom.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
M 158.99 lightning_bolt,target_if=!debuff.lightning_rod.up
0.00 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1

Sample Sequence

0245689DGMEMMCGGGGFGGGGGFGGGGGGILLLMMMIGGMMMMMFGHMMMMGMMFMMGMMJMMGFGMMMMMGFMMMMDGMGMMIMMGMMGFMMMMGHKMMMMM9FGJMMMMMGIMMMMMMGMFMMHMGMMMMIMGLLLMIMGMMEMMMGFMMC7GGGGGFGGGGGIJLG8LLMMFGHMGMMKMMMGFMMMMMG9MMFMMMMGMHMMIMMGMMJMMMFGLLLMMFGMHMMMMGLILLMGMMFMMGMMMMFMGMHMJMMGMIMMKMMGMMMFMMEGMMMMMGI9MMMMCGGGFGGGGGGFGGGLHJLLMGFMMMMMGGLILLMGMMFMMMGHMGMMFMMGM8MMIMGJKMMMM

Sample Sequence Table

time name target resources buffs
Pre flask Oshamëren 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre augmentation Oshamëren 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom potion_of_deadly_grace
Pre stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), potion_of_deadly_grace
Pre totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:01.106 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:01.106 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:01.862 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:02.838 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:03.812 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:04.566 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom bloodlust, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:05.541 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:06.518 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:06.518 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:07.493 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:08.248 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:09.224 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.198 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.955 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/100: 9% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:11.930 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:12.907 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:13.882 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:14.858 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:15.833 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:16.587 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:17.562 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:18.537 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:19.512 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.488 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:21.464 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:22.634 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:23.512 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:24.682 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:25.852 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:27.020 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:28.189 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:29.358 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:30.528 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:31.407 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:32.576 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:33.455 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:34.625 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:35.797 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:36.968 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:38.137 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:39.308 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:40.187 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:41.085 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:42.225 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:43.742 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:45.261 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:46.780 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:48.300 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:49.819 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:51.337 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:52.855 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:53.995 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:55.515 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:57.034 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:58.175 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.696 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.214 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.354 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.873 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.394 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.913 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.054 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.194 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.714 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.235 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.754 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.274 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.794 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.934 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.072 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.592 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.111 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.630 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.151 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.291 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.810 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.329 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.471 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.991 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.512 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.652 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.173 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.692 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.211 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.731 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.251 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:43.392 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.531 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.050 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.568 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.087 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.609 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.130 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.269 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.032 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.552 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.071 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.591 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.110 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.628 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.628 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:02.581 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:03.532 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:04.486 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:05.752 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:07.018 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:08.285 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:09.552 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:10.817 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:12.085 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:13.036 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:14.300 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:15.566 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:16.831 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:18.097 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.364 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:20.629 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:21.896 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.416 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.557 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.075 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.594 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.734 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.252 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.771 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.289 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.808 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.326 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.846 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.987 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.508 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.027 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.546 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.065 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.585 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.106 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.247 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.766 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.287 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.807 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.327 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.467 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.988 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.507 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.027 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.545 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/100: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.686 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.205 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.726 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.726 potion Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.726 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:08.245 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:09.764 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:11.282 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:12.801 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:14.321 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:15.461 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:16.601 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:18.120 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:19.638 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:21.157 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:22.676 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:23.816 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:24.958 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:26.477 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:27.617 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:28.758 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:30.278 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
3:31.798 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.317 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.837 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.977 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.496 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.637 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.156 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.297 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.817 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.337 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.099 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.618 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.138 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.657 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.176 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.318 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.838 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.358 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.877 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.397 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.917 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.435 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.628 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:02.894 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:04.160 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:05.110 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:06.376 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:07.641 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:08.907 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:10.174 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:11.441 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:12.707 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:13.659 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:14.927 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:16.195 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:17.146 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:18.412 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:19.678 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:20.946 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:22.213 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.732 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.958 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.477 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.997 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.517 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.654 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.174 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.692 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.210 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.730 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.250 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.770 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.911 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.429 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.950 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.091 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.608 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.128 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.649 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.169 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.689 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.209 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.348 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.869 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.389 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.908 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:01.050 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:02.570 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:04.091 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:05.232 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:06.752 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:08.272 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:09.791 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:11.310 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:12.830 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:14.348 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:15.868 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:17.009 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:18.529 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:20.049 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:21.568 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:22.710 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:24.231 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:25.370 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:26.889 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:28.409 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:29.930 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:31.450 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:32.589 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:34.109 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:35.628 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:36.390 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:37.909 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:39.429 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:40.950 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:42.470 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:43.988 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:45.507 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:46.649 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:48.168 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:49.688 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:50.830 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:51.971 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
5:53.491 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:55.013 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
5:56.532 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:58.051 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
5:59.571 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:01.090 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:02.231 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:02.231 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:03.497 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/100: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:04.761 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:06.028 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:07.295 ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:07.295 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:08.562 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:09.513 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:10.780 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:11.732 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:12.999 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:13.951 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:15.218 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:16.486 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:17.751 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:19.016 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:19.967 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:21.234 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:22.187 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
6:23.452 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:24.971 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:26.112 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:27.253 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:28.773 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:30.291 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:31.810 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:33.329 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:34.470 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:35.988 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:37.509 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:39.029 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:40.547 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:42.068 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:43.587 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:44.728 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:46.247 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:47.388 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
6:48.907 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:50.424 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:51.943 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:53.461 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:54.981 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
6:56.500 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/100: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:57.642 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
6:59.163 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:00.682 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:02.200 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:03.721 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:04.864 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:06.382 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:07.522 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:09.040 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:10.558 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:11.699 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:13.219 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:14.738 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:16.258 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:17.776 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:18.915 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:20.434 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:21.952 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:23.093 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:24.611 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:26.131 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
7:27.271 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:28.033 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:29.551 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
7:31.072 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
7:32.590 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4727 4402 0
Agility 9353 9028 0
Stamina 23388 23388 13946
Intellect 24646 22940 14521 (7328)
Spirit 2 2 0
Health 1403280 1403280 0
Mana 220000 220000 0
Maelstrom 100 100 0
Spell Power 24646 22940 0
Crit 20.49% 20.49% 5423
Haste 29.37% 29.37% 5724
Damage / Heal Versatility 3.80% 3.80% 1520
Attack Power 9353 9028 0
Mastery 31.70% 31.70% 2132
Armor 2319 2319 2319
Run Speed 7 0 0
Leech 1.63% 1.63% 375

Gear

Source Slot Average Item Level: 809.00
Local Head Vilescale Helm
ilevel: 830, stats: { 316 Armor, +1077 AgiInt, +1615 Sta, +866 Crit, +345 Haste }
Local Neck An'she's Pendant
ilevel: 810, stats: { +754 Sta, +1039 Haste, +542 Crit }
Local Shoulders Skyhorn Mantle
ilevel: 825, stats: { 287 Armor, +771 AgiInt, +1157 Sta, +561 Haste, +331 Crit }
Local Chest Chestguard of Ravaged Chitin
ilevel: 825, stats: { 383 Armor, +1028 AgiInt, +1542 Sta, +721 Haste, +467 Crit }
Local Waist Ley Dragoon's Belt
ilevel: 825, stats: { 215 Armor, +771 AgiInt, +1157 Sta, +541 Mastery, +350 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 840, stats: { 351 Armor, +1772 Sta, +1182 AgiInt, +791 Haste, +467 Crit, +674 unknown }
Local Feet Bitestone Boots
ilevel: 830, stats: { 267 Armor, +807 AgiInt, +1211 Sta, +570 Haste, +337 Vers }
Local Wrists Farseer's Wristwraps
ilevel: 810, stats: { 160 Armor, +754 Sta, +503 AgiInt, +438 Crit, +194 Vers }
Local Hands Earthguard Gloves
ilevel: 800, stats: { 221 Armor, +611 AgiInt, +916 Sta, +267 Crit, +546 Vers }
Local Finger1 Band of Sablehide
ilevel: 680, stats: { +225 Sta, +271 Mastery, +228 Crit }
Local Finger2 Roggstone Signet
ilevel: 805, stats: { +719 Sta, +1108 Haste, +443 Vers }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 805, stats: { +811 Int, +788 Mastery }
Local Trinket2 Bloom of New Growth
ilevel: 820, stats: { +933 Int, +375 Leech, +834 Crit }
Local Back Cloak of Fading Echoes
ilevel: 825, stats: { 119 Armor, +578 StrAgiInt, +867 Sta, +239 Haste, +430 Crit }
Local Main Hand The Fist of Ra-den
ilevel: 804, weapon: { 1073 - 1995, 2.6 }, stats: { +362 Int, +544 Sta, +239 Crit, +230 Mastery, +4612 Int }, relics: { +19 ilevels, +35 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 804, stats: { +475 Int, +713 Sta, +314 Crit, +302 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Elemental Blast (Elemental Shaman) Ancestral Swiftness Echo of the Elements
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Icefury (Elemental Shaman)
90 Elemental Mastery (Elemental Shaman) Storm Elemental (Elemental Shaman) Aftershock (Elemental Shaman)
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Liquid Magma Totem (Elemental Shaman)

Profile

shaman="Oshamëren"
origin="https://eu.api.battle.net/wow/character/hyjal/Oshamëren/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/26/114240282-avatar.jpg"
level=110
race=pandaren_alliance
role=spell
position=back
professions=alchemy=741/herbalism=796
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Wa!2001100
artifact=40:0:0:0:0:291:1:294:1:296:1:300:3:301:3:302:3:303:3:1350:1
spec=elemental

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/stormkeeper
actions.precombat+=/totem_mastery

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to Ascendance, unless combat will end shortly
actions+=/potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning=3&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake_totem
actions.aoe+=/lava_burst,if=buff.lava_surge.up&spell_targets.chain_lightning=3
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=!debuff.lightning_rod.up
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single target action priority list
actions.single=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single+=/flame_shock,if=!ticking
actions.single+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
actions.single+=/earth_shock,if=maelstrom>=92
actions.single+=/icefury,if=raid_event.movement.in<5
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single+=/elemental_blast
actions.single+=/earthquake_totem,if=buff.echoes_of_the_great_sundering.up
actions.single+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single+=/frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
actions.single+=/frost_shock,moving=1,if=buff.icefury.up
actions.single+=/earth_shock,if=maelstrom>=86
actions.single+=/icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
actions.single+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single+=/stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
actions.single+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single+=/lightning_bolt,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt
actions.single+=/flame_shock,moving=1,target_if=refreshable
actions.single+=/earth_shock,moving=1

head=vilescale_helm,id=121319,bonus_id=1726/1492/3339
neck=anshes_pendant,id=139101,bonus_id=1824/1472/3339
shoulders=skyhorn_mantle,id=139121,bonus_id=3396/1487/1675
back=cloak_of_fading_echoes,id=134405,bonus_id=1726/1477
chest=chestguard_of_ravaged_chitin,id=137428,bonus_id=1726/1477
wrists=farseers_wristwraps,id=139705,bonus_id=3385/3381
hands=earthguard_gloves,id=141009
waist=ley_dragoons_belt,id=134295,bonus_id=3396/1487/1675
legs=tempered_seaborne_leggings,id=133769,bonus_id=1726/43/1492/3337
feet=bitestone_boots,id=134166,bonus_id=3397/1492/1675
finger1=band_of_sablehide,id=129168,bonus_id=664/1736
finger2=roggstone_signet,id=134157,bonus_id=1824/1467/1675
trinket1=nightborne_researchers_phial,id=134292,bonus_id=1824/605/1467/1675
trinket2=bloom_of_new_growth,id=139076,bonus_id=3395/41/603/1482/1675
main_hand=the_fist_of_raden,id=128935,gem_id=133124/137340/0/0,relic_id=1792:1581:1809/1826:1472:3338/0/0
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=808.63
# gear_stamina=13946
# gear_intellect=14521
# gear_crit_rating=5423
# gear_haste_rating=5724
# gear_mastery_rating=2132
# gear_versatility_rating=1520
# gear_leech_rating=375
# gear_armor=2319

Dèmonos

Dèmonos : 203031 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
203031.4 203031.4 97.1 / 0.048% 19508.7 / 9.6% 4.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
31583.4 31583.4 Mana 0.00% 43.9 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Demon Skin
  • 60: Fire and Brimstone (Destruction Warlock)
  • 75: Dark Pact
  • 90: Grimoire of Service
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • tailoring: 19
  • enchanting: 618

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Dèmonos 203031
Chaos Bolt 49634 24.5% 51.2 8.66sec 436417 277123 Direct 51.9 0 430261 430261 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.21 51.95 0.00 0.00 1.5748 0.0000 22350777.01 22350777.01 0.00 277122.70 277122.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.95 100.00% 430260.88 303512 557185 430248.63 387952 467172 22350777 22350777 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 12908 6.4% 47.0 9.65sec 123735 100582 Direct 47.0 102688 205431 123731 20.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.95 46.95 0.00 0.00 1.2302 0.0000 5809843.03 5809843.03 0.00 100582.44 100582.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.34 79.52% 102688.10 72450 133004 102689.46 90157 112522 3834122 3834122 0.00
crit 9.62 20.48% 205431.03 144901 266007 205400.53 0 261845 1975721 1975721 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5278 2.6% 23.4 20.01sec 99962 0 Direct 23.4 82904 165808 99963 20.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 0.0000 0.0000 2339426.88 2339426.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 79.42% 82903.95 82904 82904 82903.95 82904 82904 1541015 1541015 0.00
crit 4.82 20.58% 165807.90 165808 165808 165028.52 0 165808 798412 798412 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 23997 11.8% 25.5 17.93sec 423927 343780 Direct 25.5 71269 142477 85842 20.5%  
Periodic 185.9 38488 77005 46373 20.5% 99.2%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.50 25.50 185.89 185.89 1.2331 2.4045 10809143.69 10809143.69 0.00 22593.70 343780.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.28 79.53% 71268.55 50265 92276 71259.51 61182 81652 1445314 1445314 0.00
crit 5.22 20.47% 142476.58 100531 184552 141897.58 0 184448 743492 743492 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.8 79.53% 38488.10 3352 49982 38489.53 36332 40875 5689749 5689749 0.00
crit 38.1 20.47% 77004.95 3032 99963 77003.40 67344 85497 2930589 2930589 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFF{$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 54989 27.1% 174.5 2.54sec 142019 101725 Direct 173.7 118367 236692 142635 20.5%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 174.47 173.71 0.00 0.00 1.3961 0.0000 24777495.98 24777495.98 0.00 101724.72 101724.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.08 79.49% 118367.15 83489 153268 118365.07 110226 126079 16344402 16344402 0.00
crit 35.63 20.51% 236691.55 166977 306537 236691.51 207600 264418 8433094 8433094 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.96
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.remains
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 14145 / 14145
Firebolt 14145 7.0% 140.8 3.20sec 45235 31578 Direct 140.1 37728 75455 45474 20.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.80 140.06 0.00 0.00 1.4325 0.0000 6369100.10 6369100.10 0.00 31578.03 31578.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.30 79.47% 37727.97 25215 37823 37726.65 37500 37823 4199228 4199228 0.00
crit 28.76 20.53% 75454.87 50431 75646 75453.25 73354 75646 2169872 2169872 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 41756 / 13142
Firebolt 41756 6.5% 65.2 6.56sec 90693 64744 Direct 64.9 75637 151274 91179 20.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.21 64.87 0.00 0.00 1.4008 0.0000 5914503.83 5914503.83 0.00 64744.11 64744.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.54 79.45% 75637.35 50431 75646 75637.33 74761 75646 3898068 3898068 0.00
crit 13.33 20.55% 151273.57 100861 151292 151273.48 144088 151292 2016436 2016436 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - doomguard 29034 / 4612
Doom Bolt 29034 2.3% 28.6 13.31sec 72219 31651 Direct 28.5 60190 120423 72491 20.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.57 28.47 0.00 0.00 2.2817 0.0000 2063484.56 2063484.56 0.00 31650.96 31650.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.65 79.58% 60189.62 58424 70109 60124.34 58424 63959 1363358 1363358 0.00
crit 5.81 20.42% 120422.85 116849 140219 120054.93 0 140219 700126 700126 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - shadowy_tear 53369 / 9898
Shadow Bolt 53369 4.9% 7.0 59.94sec 632325 0 Periodic 64.2 57537 114999 69343 20.5% 21.4%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 0.00 64.41 64.16 0.0000 1.4989 4449249.92 4449249.92 0.00 46084.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.0 79.45% 57537.12 9933 61499 57538.79 53056 61499 2933183 2933183 0.00
crit 13.2 20.55% 114998.85 19867 122999 114832.08 0 122999 1516067 1516067 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 77726 / 5735
Chaos Bolt 77726 2.8% 7.0 59.64sec 368669 150618 Direct 7.0 0 370565 370565 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 6.96 0.00 0.00 2.4478 0.0000 2580091.84 2580091.84 0.00 150618.32 150618.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 6.96 100.00% 370565.42 370565 370565 370528.34 0 370565 2580092 2580092 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 117806 / 8710
Chaos Barrage 117806 4.3% 7.1 60.01sec 554957 0 Periodic 197.5 16453 32892 19821 20.5% 8.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 0.00 198.14 197.45 0.0000 0.1939 3913737.84 3913737.84 0.00 101848.64 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.0 79.51% 16452.92 966 16913 16453.19 16083 16913 2583067 2583067 0.00
crit 40.5 20.49% 32891.88 1933 33826 32892.67 24698 33826 1330671 1330671 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Dèmonos
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
Dimensional Rift 21.1 22.15sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.11 0.00 0.00 0.00 1.2279 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dèmonos
  • harmful:false
  • if_expr:
 
Life Tap 0.0 0.00sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.2676 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mana_tap.enabled&mana.pct<=10
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 5.4 91.01sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 0.00 0.00 1.2136 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Summon Doomguard 2.9 183.07sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.93 0.00 0.00 0.00 1.1677 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 47.0 0.0 9.6sec 9.6sec 42.40% 42.70% 0.0(0.0) 46.5

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_backdraft
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:42.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 405.6sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Dèmonos
chaos_bolt Soul Shard 52.2 104.4 2.0 2.0 214042.2
conflagrate Mana 47.0 1032990.9 22000.0 22000.0 5.6
immolate Mana 25.5 1682818.6 66000.0 65999.0 6.4
incinerate Mana 174.5 11515077.4 66000.0 66001.9 2.2
service_imp Soul Shard 5.4 5.4 1.0 1.0 0.0
summon_doomguard Soul Shard 2.9 2.9 1.0 1.0 0.0
pet - imp
firebolt Energy 140.8 5632.0 40.0 40.0 1130.9
pet - service_imp
firebolt Energy 65.2 2608.5 40.0 40.0 2267.4
pet - doomguard
doom_bolt Energy 28.6 1000.1 35.0 35.0 2063.3
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 33.61 33.60 (30.30%) 1.00 0.00 0.01%
conflagrate Soul Shard 46.95 46.95 (42.34%) 1.00 0.00 0.00%
life_tap Mana 0.00 1582.89 (0.01%) 330000.00 0.00 0.00%
mp5_regen Mana 596.91 5183680.69 (36.90%) 8684.23 857993.35 14.20%
soul_conduit Soul Shard 22.53 22.53 (20.32%) 1.00 0.00 0.00%
reverse_entropy Mana 52.21 8861295.42 (63.09%) 169720.36 11239998.17 55.92%
soulsnatcher Soul Shard 7.81 7.81 (7.04%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 2766.87 5465.98 (100.00%) 1.98 22.75 0.41%
pet - service_imp
energy_regen Energy 566.05 1680.70 (100.00%) 2.97 94.36 5.32%
pet - doomguard
energy_regen Energy 28.57 898.46 (100.00%) 31.44 130.01 12.64%
Resource RPS-Gain RPS-Loss
Health 1.72 1.86
Mana 31174.15 31583.44
Soul Shard 0.25 0.25
Combat End Resource Mean Min Max
Mana 914511.59 133674.50 1100000.00
Soul Shard 1.14 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.1%

Procs

Count Interval
shadowy_tear 7.0 59.1sec
chaos_tear 7.0 59.4sec
chaos_portal 7.0 59.1sec
dimension_ripper 8.7 45.6sec
soul_conduit 22.5 21.3sec

Statistics & Data Analysis

Fight Length
Sample Data Dèmonos Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Dèmonos Damage Per Second
Count 9999
Mean 203031.41
Minimum 186603.90
Maximum 224413.63
Spread ( max - min ) 37809.73
Range [ ( max - min ) / 2 * 100% ] 9.31%
Standard Deviation 4951.8436
5th Percentile 195126.08
95th Percentile 211481.14
( 95th Percentile - 5th Percentile ) 16355.05
Mean Distribution
Standard Deviation 49.5209
95.00% Confidence Intervall ( 202934.35 - 203128.47 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2285
0.1 Scale Factor Error with Delta=300 209323
0.05 Scale Factor Error with Delta=300 837293
0.01 Scale Factor Error with Delta=300 20932326
Priority Target DPS
Sample Data Dèmonos Priority Target Damage Per Second
Count 9999
Mean 203031.41
Minimum 186603.90
Maximum 224413.63
Spread ( max - min ) 37809.73
Range [ ( max - min ) / 2 * 100% ] 9.31%
Standard Deviation 4951.8436
5th Percentile 195126.08
95th Percentile 211481.14
( 95th Percentile - 5th Percentile ) 16355.05
Mean Distribution
Standard Deviation 49.5209
95.00% Confidence Intervall ( 202934.35 - 203128.47 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2285
0.1 Scale Factor Error with Delta=300 209323
0.05 Scale Factor Error with Delta=300 837293
0.01 Scale Factor Error with Delta=300 20932326
DPS(e)
Sample Data Dèmonos Damage Per Second (Effective)
Count 9999
Mean 203031.41
Minimum 186603.90
Maximum 224413.63
Spread ( max - min ) 37809.73
Range [ ( max - min ) / 2 * 100% ] 9.31%
Damage
Sample Data Dèmonos Damage
Count 9999
Mean 66086686.59
Minimum 49458237.22
Maximum 85752346.70
Spread ( max - min ) 36294109.48
Range [ ( max - min ) / 2 * 100% ] 27.46%
DTPS
Sample Data Dèmonos Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Dèmonos Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Dèmonos Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Dèmonos Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Dèmonos Healing Taken Per Second
Count 9999
Mean 1.70
Minimum 0.00
Maximum 462.10
Spread ( max - min ) 462.10
Range [ ( max - min ) / 2 * 100% ] 13591.21%
TMI
Sample Data Dèmonos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DèmonosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Dèmonos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 potion,name=deadly_grace
A 0.00 mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
0.00 havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
C 1.24 dimensional_rift,if=charges=3
D 11.96 immolate,if=remains<=tick_time
0.00 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
E 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
F 46.96 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
G 5.42 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
H 2.93 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
I 39.99 chaos_bolt,if=soul_shard>3|buff.backdraft.remains
0.00 chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
J 79.64 incinerate,if=buff.backdraft.remains
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
K 19.87 dimensional_rift
0.00 mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
L 11.39 chaos_bolt
0.00 cataclysm
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
M 13.61 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
0.00 life_tap,if=talent.mana_tap.enabled&mana.pct<=10
N 95.37 incinerate
O 0.00 life_tap

Sample Sequence

01269BCDFGHJFJJJKFIIKMNNFJIJNNNFIJJNKNFIJDNNNFIJJKKNNFIDJNNNFIJJNLFDIJNNNFIJJNMNKFGJJNNNFIJJMNLFIJJNNNFJJDKNNFIJJKNNMFIINNKNFJIJNMNFJJJNNNFIIMNKLFGHJNNNFIJJDKNNFIINNLFIDJNLFIJJKNMNFIINNNFIJJNMNNFJJJNLNFIJJDKNFGJJNNNFIJIDNNFIJJNNNFJDJNKNKFIJJKNMNFIJJNNNFJJJMNNFIJJKNNFIJJKDKNFGHJNNNFIJDNNNFIJJNNMFIJIKLENFJJJKMNLFJJJNNKFIJJMNKNFJIJNNNFJJDKL

Sample Sequence Table

time name target resources buffs
Pre flask Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Dèmonos 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.000 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:01.206 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:02.183 conflagrate Fluffy_Pillow 1034101.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:03.158 service_imp Fluffy_Pillow 1028654.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:04.132 summon_doomguard Fluffy_Pillow 1045189.1/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:05.107 incinerate Fluffy_Pillow 1061741.2/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:06.000 conflagrate Fluffy_Pillow 1010901.2/1100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:06.975 incinerate Fluffy_Pillow 1005453.3/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:07.868 incinerate Fluffy_Pillow 954613.4/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:08.760 incinerate Fluffy_Pillow 903756.4/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:09.654 dimensional_rift Fluffy_Pillow 852933.4/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:10.631 conflagrate Fluffy_Pillow 869519.5/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, potion_of_deadly_grace
0:11.606 chaos_bolt Fluffy_Pillow 864071.6/1100000: 79% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:12.744 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:13.882 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:14.858 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:15.833 incinerate Fluffy_Pillow 1034067.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:17.106 incinerate Fluffy_Pillow 989679.0/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:18.381 conflagrate Fluffy_Pillow 945324.1/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, potion_of_deadly_grace
0:19.357 incinerate Fluffy_Pillow 939893.2/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:20.249 chaos_bolt Fluffy_Pillow 889036.2/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:21.386 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:22.280 incinerate Fluffy_Pillow 1034101.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:23.555 incinerate Fluffy_Pillow 989746.9/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust
0:24.828 incinerate Fluffy_Pillow 945358.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust
0:26.101 conflagrate Fluffy_Pillow 900969.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust
0:27.076 chaos_bolt Fluffy_Pillow 895521.2/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, backdraft
0:28.214 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:29.106 incinerate Fluffy_Pillow 1034067.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:29.999 incinerate Fluffy_Pillow 983227.9/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust
0:31.273 dimensional_rift Fluffy_Pillow 938856.0/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust
0:32.249 incinerate Fluffy_Pillow 955425.1/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust
0:33.523 conflagrate Fluffy_Pillow 911053.2/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust
0:34.498 chaos_bolt Fluffy_Pillow 905605.3/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, backdraft
0:35.634 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:36.527 immolate Fluffy_Pillow 1034084.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft
0:37.504 incinerate Fluffy_Pillow 984670.9/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust
0:38.779 incinerate Fluffy_Pillow 940316.0/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust
0:40.052 incinerate Fluffy_Pillow 895927.1/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust
0:41.325 conflagrate Fluffy_Pillow 846551.0/1100000: 77% mana | 1.0/5: 20% soul_shard
0:42.592 chaos_bolt Fluffy_Pillow 841096.6/1100000: 76% mana | 2.0/5: 40% soul_shard backdraft
0:44.067 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
0:45.226 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
0:46.386 dimensional_rift Fluffy_Pillow 983200.5/1100000: 89% mana | 0.0/5: 0% soul_shard
0:47.654 dimensional_rift Fluffy_Pillow 999759.2/1100000: 91% mana | 1.0/5: 20% soul_shard
0:48.921 incinerate Fluffy_Pillow 1016304.7/1100000: 92% mana | 1.0/5: 20% soul_shard
0:50.574 incinerate Fluffy_Pillow 971891.0/1100000: 88% mana | 1.0/5: 20% soul_shard
0:52.229 conflagrate Fluffy_Pillow 927503.4/1100000: 84% mana | 1.0/5: 20% soul_shard
0:53.497 chaos_bolt Fluffy_Pillow 922062.1/1100000: 84% mana | 2.0/5: 40% soul_shard backdraft
0:54.975 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
0:56.243 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
0:57.402 incinerate Fluffy_Pillow 983200.5/1100000: 89% mana | 0.0/5: 0% soul_shard
0:59.057 incinerate Fluffy_Pillow 938812.9/1100000: 85% mana | 1.0/5: 20% soul_shard
1:00.713 incinerate Fluffy_Pillow 894438.4/1100000: 81% mana | 1.0/5: 20% soul_shard
1:02.368 conflagrate Fluffy_Pillow 850050.8/1100000: 77% mana | 1.0/5: 20% soul_shard
1:03.635 chaos_bolt Fluffy_Pillow 844596.4/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft
1:05.113 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
1:06.274 incinerate Fluffy_Pillow 1034078.4/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
1:07.434 incinerate Fluffy_Pillow 983226.6/1100000: 89% mana | 1.0/5: 20% soul_shard
1:09.090 chaos_bolt Fluffy_Pillow 938852.1/1100000: 85% mana | 2.0/5: 40% soul_shard
1:11.199 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:12.667 immolate Fluffy_Pillow 1094545.6/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
1:13.935 chaos_bolt Fluffy_Pillow 1034065.3/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft
1:15.414 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
1:16.573 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 1.0/5: 20% soul_shard
1:18.228 incinerate Fluffy_Pillow 989664.7/1100000: 90% mana | 1.0/5: 20% soul_shard
1:19.882 incinerate Fluffy_Pillow 945264.0/1100000: 86% mana | 1.0/5: 20% soul_shard
1:21.535 conflagrate Fluffy_Pillow 900850.3/1100000: 82% mana | 1.0/5: 20% soul_shard
1:22.801 chaos_bolt Fluffy_Pillow 895382.8/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft
1:24.278 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
1:25.437 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
1:26.596 incinerate Fluffy_Pillow 983187.5/1100000: 89% mana | 0.0/5: 0% soul_shard
1:28.250 immolate Fluffy_Pillow 938786.8/1100000: 85% mana | 0.0/5: 0% soul_shard
1:29.517 incinerate Fluffy_Pillow 889332.4/1100000: 81% mana | 0.0/5: 0% soul_shard
1:31.173 dimensional_rift Fluffy_Pillow 844957.9/1100000: 77% mana | 0.0/5: 0% soul_shard
1:32.441 conflagrate Fluffy_Pillow 861516.5/1100000: 78% mana | 1.0/5: 20% soul_shard
1:33.709 service_imp Fluffy_Pillow 856075.1/1100000: 78% mana | 2.0/5: 40% soul_shard backdraft
1:34.976 incinerate Fluffy_Pillow 872620.7/1100000: 79% mana | 1.0/5: 20% soul_shard backdraft
1:36.136 incinerate Fluffy_Pillow 821769.0/1100000: 75% mana | 1.0/5: 20% soul_shard backdraft
1:37.296 incinerate Fluffy_Pillow 770917.3/1100000: 70% mana | 1.0/5: 20% soul_shard
1:38.950 incinerate Fluffy_Pillow 726516.6/1100000: 66% mana | 1.0/5: 20% soul_shard
1:40.603 incinerate Fluffy_Pillow 682102.9/1100000: 62% mana | 1.0/5: 20% soul_shard
1:42.259 conflagrate Fluffy_Pillow 637728.4/1100000: 58% mana | 1.0/5: 20% soul_shard
1:43.528 chaos_bolt Fluffy_Pillow 632300.1/1100000: 57% mana | 2.0/5: 40% soul_shard backdraft
1:45.005 incinerate Fluffy_Pillow 1036588.0/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
1:46.165 incinerate Fluffy_Pillow 985736.3/1100000: 90% mana | 0.0/5: 0% soul_shard backdraft
1:47.323 immolate Fluffy_Pillow 934858.5/1100000: 85% mana | 1.0/5: 20% soul_shard
1:48.590 incinerate Fluffy_Pillow 885404.1/1100000: 80% mana | 1.0/5: 20% soul_shard
1:50.244 chaos_bolt Fluffy_Pillow 841003.4/1100000: 76% mana | 2.0/5: 40% soul_shard
1:52.352 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:53.618 chaos_bolt Fluffy_Pillow 1094532.5/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
1:55.096 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
1:56.254 incinerate Fluffy_Pillow 1034039.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
1:57.412 incinerate Fluffy_Pillow 983161.3/1100000: 89% mana | 0.0/5: 0% soul_shard
1:59.068 incinerate Fluffy_Pillow 938786.8/1100000: 85% mana | 0.0/5: 0% soul_shard
2:00.722 incinerate Fluffy_Pillow 894386.2/1100000: 81% mana | 0.0/5: 0% soul_shard
2:02.377 conflagrate Fluffy_Pillow 849998.6/1100000: 77% mana | 0.0/5: 0% soul_shard
2:03.645 incinerate Fluffy_Pillow 844557.2/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
2:04.804 incinerate Fluffy_Pillow 793692.4/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
2:05.964 immolate Fluffy_Pillow 742840.7/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
2:07.231 dimensional_rift Fluffy_Pillow 693386.3/1100000: 63% mana | 1.0/5: 20% soul_shard
2:08.499 incinerate Fluffy_Pillow 709944.9/1100000: 65% mana | 1.0/5: 20% soul_shard
2:10.153 incinerate Fluffy_Pillow 665544.3/1100000: 61% mana | 1.0/5: 20% soul_shard
2:11.809 conflagrate Fluffy_Pillow 621169.8/1100000: 56% mana | 1.0/5: 20% soul_shard
2:13.315 chaos_bolt Fluffy_Pillow 618836.4/1100000: 56% mana | 2.0/5: 40% soul_shard backdraft
2:14.793 incinerate Fluffy_Pillow 1023137.4/1100000: 93% mana | 0.0/5: 0% soul_shard backdraft
2:15.951 incinerate Fluffy_Pillow 972259.6/1100000: 88% mana | 1.0/5: 20% soul_shard backdraft
2:17.112 dimensional_rift Fluffy_Pillow 921420.9/1100000: 84% mana | 1.0/5: 20% soul_shard
2:18.380 incinerate Fluffy_Pillow 937979.5/1100000: 85% mana | 1.0/5: 20% soul_shard
2:20.034 incinerate Fluffy_Pillow 893578.9/1100000: 81% mana | 1.0/5: 20% soul_shard
2:21.690 immolate Fluffy_Pillow 849204.4/1100000: 77% mana | 1.0/5: 20% soul_shard
2:22.958 conflagrate Fluffy_Pillow 799763.0/1100000: 73% mana | 1.0/5: 20% soul_shard
2:24.224 chaos_bolt Fluffy_Pillow 794295.5/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft
2:25.700 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
2:27.176 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
2:28.828 incinerate Fluffy_Pillow 1034026.1/1100000: 94% mana | 0.0/5: 0% soul_shard
2:30.484 dimensional_rift Fluffy_Pillow 989651.6/1100000: 90% mana | 0.0/5: 0% soul_shard
2:31.752 incinerate Fluffy_Pillow 1006210.2/1100000: 91% mana | 0.0/5: 0% soul_shard
2:33.406 conflagrate Fluffy_Pillow 961809.6/1100000: 87% mana | 0.0/5: 0% soul_shard
2:34.672 incinerate Fluffy_Pillow 956342.1/1100000: 87% mana | 1.0/5: 20% soul_shard backdraft
2:35.832 chaos_bolt Fluffy_Pillow 905490.4/1100000: 82% mana | 2.0/5: 40% soul_shard backdraft
2:37.310 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
2:38.470 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 0.0/5: 0% soul_shard
2:40.124 immolate Fluffy_Pillow 989664.7/1100000: 90% mana | 0.0/5: 0% soul_shard
2:41.391 incinerate Fluffy_Pillow 940210.2/1100000: 85% mana | 0.0/5: 0% soul_shard
2:43.047 conflagrate Fluffy_Pillow 895835.7/1100000: 81% mana | 0.0/5: 0% soul_shard
2:44.314 incinerate Fluffy_Pillow 890381.3/1100000: 81% mana | 1.0/5: 20% soul_shard backdraft
2:45.473 incinerate Fluffy_Pillow 839516.5/1100000: 76% mana | 1.0/5: 20% soul_shard backdraft
2:46.633 incinerate Fluffy_Pillow 788664.8/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
2:47.792 incinerate Fluffy_Pillow 737800.0/1100000: 67% mana | 1.0/5: 20% soul_shard
2:49.447 incinerate Fluffy_Pillow 693412.4/1100000: 63% mana | 1.0/5: 20% soul_shard
2:51.100 incinerate Fluffy_Pillow 648998.7/1100000: 59% mana | 1.0/5: 20% soul_shard
2:52.757 conflagrate Fluffy_Pillow 604637.2/1100000: 55% mana | 1.0/5: 20% soul_shard
2:54.025 chaos_bolt Fluffy_Pillow 599195.9/1100000: 54% mana | 3.0/5: 60% soul_shard backdraft
2:55.504 chaos_bolt Fluffy_Pillow 1003509.9/1100000: 91% mana | 2.0/5: 40% soul_shard backdraft
2:56.982 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
2:58.252 incinerate Fluffy_Pillow 1034091.4/1100000: 94% mana | 1.0/5: 20% soul_shard
2:59.906 dimensional_rift Fluffy_Pillow 989690.8/1100000: 90% mana | 1.0/5: 20% soul_shard
3:01.268 chaos_bolt Fluffy_Pillow 1007476.9/1100000: 92% mana | 2.0/5: 40% soul_shard
3:03.378 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:04.645 service_imp Fluffy_Pillow 1094545.6/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
3:05.913 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
3:07.180 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
3:08.340 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 1.0/5: 20% soul_shard
3:09.994 incinerate Fluffy_Pillow 989664.7/1100000: 90% mana | 1.0/5: 20% soul_shard
3:11.649 incinerate Fluffy_Pillow 945277.1/1100000: 86% mana | 1.0/5: 20% soul_shard
3:13.303 conflagrate Fluffy_Pillow 900876.4/1100000: 82% mana | 1.0/5: 20% soul_shard
3:14.570 chaos_bolt Fluffy_Pillow 895422.0/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft
3:16.048 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
3:17.208 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
3:18.366 immolate Fluffy_Pillow 983187.5/1100000: 89% mana | 0.0/5: 0% soul_shard
3:19.634 dimensional_rift Fluffy_Pillow 933746.1/1100000: 85% mana | 0.0/5: 0% soul_shard
3:20.899 incinerate Fluffy_Pillow 950265.6/1100000: 86% mana | 0.0/5: 0% soul_shard
3:22.553 incinerate Fluffy_Pillow 905864.9/1100000: 82% mana | 0.0/5: 0% soul_shard
3:24.209 conflagrate Fluffy_Pillow 861490.4/1100000: 78% mana | 1.0/5: 20% soul_shard
3:25.476 chaos_bolt Fluffy_Pillow 856036.0/1100000: 78% mana | 3.0/5: 60% soul_shard backdraft
3:26.954 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
3:28.433 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:30.089 incinerate Fluffy_Pillow 1034078.4/1100000: 94% mana | 1.0/5: 20% soul_shard
3:31.744 chaos_bolt Fluffy_Pillow 989690.8/1100000: 90% mana | 2.0/5: 40% soul_shard
3:33.852 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:35.120 chaos_bolt Fluffy_Pillow 1094558.6/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
3:36.598 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
3:37.864 incinerate Fluffy_Pillow 1034039.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
3:39.022 incinerate Fluffy_Pillow 983161.3/1100000: 89% mana | 1.0/5: 20% soul_shard
3:40.676 chaos_bolt Fluffy_Pillow 938760.7/1100000: 85% mana | 2.0/5: 40% soul_shard
3:42.785 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:44.287 chaos_bolt Fluffy_Pillow 1094545.6/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
3:45.763 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
3:46.923 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
3:48.084 dimensional_rift Fluffy_Pillow 983226.6/1100000: 89% mana | 0.0/5: 0% soul_shard
3:49.351 incinerate Fluffy_Pillow 999772.2/1100000: 91% mana | 0.0/5: 0% soul_shard
3:51.005 immolate Fluffy_Pillow 955371.6/1100000: 87% mana | 0.0/5: 0% soul_shard
3:52.273 incinerate Fluffy_Pillow 905930.2/1100000: 82% mana | 0.0/5: 0% soul_shard
3:53.929 conflagrate Fluffy_Pillow 861555.7/1100000: 78% mana | 1.0/5: 20% soul_shard
3:55.196 chaos_bolt Fluffy_Pillow 856101.3/1100000: 78% mana | 2.0/5: 40% soul_shard backdraft
3:56.674 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft
3:58.152 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:59.806 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard
4:01.460 incinerate Fluffy_Pillow 989651.6/1100000: 90% mana | 1.0/5: 20% soul_shard
4:03.115 conflagrate Fluffy_Pillow 945264.0/1100000: 86% mana | 1.0/5: 20% soul_shard
4:04.504 chaos_bolt Fluffy_Pillow 941402.8/1100000: 86% mana | 2.0/5: 40% soul_shard backdraft
4:05.982 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
4:07.141 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
4:08.299 incinerate Fluffy_Pillow 983174.4/1100000: 89% mana | 0.0/5: 0% soul_shard
4:09.954 immolate Fluffy_Pillow 938786.8/1100000: 85% mana | 0.0/5: 0% soul_shard
4:11.223 incinerate Fluffy_Pillow 889358.5/1100000: 81% mana | 0.0/5: 0% soul_shard
4:12.878 incinerate Fluffy_Pillow 844970.9/1100000: 77% mana | 0.0/5: 0% soul_shard
4:14.531 conflagrate Fluffy_Pillow 800557.2/1100000: 73% mana | 0.0/5: 0% soul_shard
4:15.799 incinerate Fluffy_Pillow 795115.9/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
4:16.959 incinerate Fluffy_Pillow 744264.1/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
4:18.119 incinerate Fluffy_Pillow 693412.4/1100000: 63% mana | 1.0/5: 20% soul_shard backdraft
4:19.280 incinerate Fluffy_Pillow 642573.8/1100000: 58% mana | 1.0/5: 20% soul_shard
4:20.935 chaos_bolt Fluffy_Pillow 598186.2/1100000: 54% mana | 2.0/5: 40% soul_shard
4:23.043 incinerate Fluffy_Pillow 1010714.3/1100000: 92% mana | 0.0/5: 0% soul_shard
4:24.698 conflagrate Fluffy_Pillow 966326.7/1100000: 88% mana | 1.0/5: 20% soul_shard
4:25.966 chaos_bolt Fluffy_Pillow 960885.3/1100000: 87% mana | 2.0/5: 40% soul_shard backdraft
4:27.444 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
4:28.603 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
4:29.762 immolate Fluffy_Pillow 983187.5/1100000: 89% mana | 1.0/5: 20% soul_shard
4:31.030 dimensional_rift Fluffy_Pillow 933746.1/1100000: 85% mana | 1.0/5: 20% soul_shard
4:32.299 incinerate Fluffy_Pillow 950317.8/1100000: 86% mana | 1.0/5: 20% soul_shard
4:33.954 conflagrate Fluffy_Pillow 905930.2/1100000: 82% mana | 1.0/5: 20% soul_shard
4:35.219 service_imp Fluffy_Pillow 900449.7/1100000: 82% mana | 2.0/5: 40% soul_shard backdraft
4:36.487 incinerate Fluffy_Pillow 917008.3/1100000: 83% mana | 1.0/5: 20% soul_shard backdraft
4:37.646 incinerate Fluffy_Pillow 866143.5/1100000: 79% mana | 1.0/5: 20% soul_shard backdraft
4:38.806 incinerate Fluffy_Pillow 815291.8/1100000: 74% mana | 1.0/5: 20% soul_shard
4:40.460 incinerate Fluffy_Pillow 770891.2/1100000: 70% mana | 1.0/5: 20% soul_shard
4:42.115 incinerate Fluffy_Pillow 726503.6/1100000: 66% mana | 1.0/5: 20% soul_shard
4:43.769 conflagrate Fluffy_Pillow 682102.9/1100000: 62% mana | 2.0/5: 40% soul_shard
4:45.038 chaos_bolt Fluffy_Pillow 676674.6/1100000: 62% mana | 3.0/5: 60% soul_shard backdraft
4:46.515 incinerate Fluffy_Pillow 1080962.6/1100000: 98% mana | 1.0/5: 20% soul_shard backdraft
4:47.674 chaos_bolt Fluffy_Pillow 1030097.8/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft
4:49.151 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
4:50.419 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 1.0/5: 20% soul_shard
4:52.073 incinerate Fluffy_Pillow 989664.7/1100000: 90% mana | 1.0/5: 20% soul_shard
4:53.727 conflagrate Fluffy_Pillow 945264.0/1100000: 86% mana | 1.0/5: 20% soul_shard
4:55.042 chaos_bolt Fluffy_Pillow 940436.4/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft
4:56.521 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
4:57.680 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
4:58.838 incinerate Fluffy_Pillow 983174.4/1100000: 89% mana | 0.0/5: 0% soul_shard
5:00.492 incinerate Fluffy_Pillow 938773.8/1100000: 85% mana | 0.0/5: 0% soul_shard
5:02.146 incinerate Fluffy_Pillow 894373.1/1100000: 81% mana | 0.0/5: 0% soul_shard
5:03.801 conflagrate Fluffy_Pillow 849985.5/1100000: 77% mana | 0.0/5: 0% soul_shard
5:05.152 incinerate Fluffy_Pillow 845628.0/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
5:06.311 immolate Fluffy_Pillow 794763.3/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
5:07.579 incinerate Fluffy_Pillow 745321.9/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
5:08.738 incinerate Fluffy_Pillow 694457.1/1100000: 63% mana | 1.0/5: 20% soul_shard
5:10.393 dimensional_rift Fluffy_Pillow 650069.5/1100000: 59% mana | 1.0/5: 20% soul_shard
5:11.663 incinerate Fluffy_Pillow 666654.3/1100000: 61% mana | 1.0/5: 20% soul_shard
5:13.314 dimensional_rift Fluffy_Pillow 622214.5/1100000: 57% mana | 1.0/5: 20% soul_shard
5:14.583 conflagrate Fluffy_Pillow 638786.2/1100000: 58% mana | 1.0/5: 20% soul_shard
5:15.851 chaos_bolt Fluffy_Pillow 633344.8/1100000: 58% mana | 2.0/5: 40% soul_shard backdraft
5:17.328 incinerate Fluffy_Pillow 1037632.7/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
5:18.489 incinerate Fluffy_Pillow 986794.1/1100000: 90% mana | 1.0/5: 20% soul_shard backdraft
5:19.648 dimensional_rift Fluffy_Pillow 935929.3/1100000: 85% mana | 1.0/5: 20% soul_shard
5:20.914 incinerate Fluffy_Pillow 952461.8/1100000: 87% mana | 1.0/5: 20% soul_shard
5:22.568 immolate Fluffy_Pillow 908061.2/1100000: 83% mana | 1.0/5: 20% soul_shard
5:23.837 incinerate Fluffy_Pillow 858632.9/1100000: 78% mana | 1.0/5: 20% soul_shard
5:25.492 conflagrate Fluffy_Pillow 814245.3/1100000: 74% mana | 1.0/5: 20% soul_shard
5:26.760 chaos_bolt Fluffy_Pillow 808803.9/1100000: 74% mana | 2.0/5: 40% soul_shard backdraft
5:28.238 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
5:29.398 incinerate Fluffy_Pillow 1034065.3/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
5:30.556 incinerate Fluffy_Pillow 983187.5/1100000: 89% mana | 0.0/5: 0% soul_shard
5:32.211 incinerate Fluffy_Pillow 938799.9/1100000: 85% mana | 0.0/5: 0% soul_shard
5:33.865 incinerate Fluffy_Pillow 894399.2/1100000: 81% mana | 0.0/5: 0% soul_shard
5:35.521 conflagrate Fluffy_Pillow 850024.7/1100000: 77% mana | 0.0/5: 0% soul_shard
5:36.788 incinerate Fluffy_Pillow 844570.3/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
5:37.947 incinerate Fluffy_Pillow 793705.5/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
5:39.107 incinerate Fluffy_Pillow 742853.8/1100000: 68% mana | 1.0/5: 20% soul_shard backdraft
5:40.266 immolate Fluffy_Pillow 691989.0/1100000: 63% mana | 1.0/5: 20% soul_shard
5:41.533 incinerate Fluffy_Pillow 642534.6/1100000: 58% mana | 1.0/5: 20% soul_shard
5:43.188 incinerate Fluffy_Pillow 598147.0/1100000: 54% mana | 1.0/5: 20% soul_shard
5:44.840 conflagrate Fluffy_Pillow 553720.2/1100000: 50% mana | 2.0/5: 40% soul_shard
5:46.108 chaos_bolt Fluffy_Pillow 548278.9/1100000: 50% mana | 3.0/5: 60% soul_shard backdraft
5:47.585 incinerate Fluffy_Pillow 952566.8/1100000: 87% mana | 1.0/5: 20% soul_shard backdraft
5:48.745 incinerate Fluffy_Pillow 901715.1/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft
5:49.904 dimensional_rift Fluffy_Pillow 850850.3/1100000: 77% mana | 1.0/5: 20% soul_shard
5:51.171 incinerate Fluffy_Pillow 867395.9/1100000: 79% mana | 1.0/5: 20% soul_shard
5:52.826 incinerate Fluffy_Pillow 823008.3/1100000: 75% mana | 1.0/5: 20% soul_shard
5:54.482 conflagrate Fluffy_Pillow 778633.8/1100000: 71% mana | 2.0/5: 40% soul_shard
5:55.750 chaos_bolt Fluffy_Pillow 773192.4/1100000: 70% mana | 3.0/5: 60% soul_shard backdraft
5:57.226 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
5:58.384 incinerate Fluffy_Pillow 1034039.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
5:59.543 dimensional_rift Fluffy_Pillow 983174.4/1100000: 89% mana | 1.0/5: 20% soul_shard
6:00.810 immolate Fluffy_Pillow 999720.0/1100000: 91% mana | 1.0/5: 20% soul_shard
6:02.077 dimensional_rift Fluffy_Pillow 950265.6/1100000: 86% mana | 1.0/5: 20% soul_shard
6:03.344 incinerate Fluffy_Pillow 966811.1/1100000: 88% mana | 1.0/5: 20% soul_shard
6:04.999 conflagrate Fluffy_Pillow 922423.5/1100000: 84% mana | 1.0/5: 20% soul_shard
6:06.266 service_imp Fluffy_Pillow 916969.1/1100000: 83% mana | 2.0/5: 40% soul_shard backdraft
6:07.533 summon_doomguard Fluffy_Pillow 933514.7/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft
6:08.801 incinerate Fluffy_Pillow 950073.3/1100000: 86% mana | 1.0/5: 20% soul_shard backdraft
6:09.960 incinerate Fluffy_Pillow 899208.6/1100000: 82% mana | 1.0/5: 20% soul_shard
6:11.613 incinerate Fluffy_Pillow 854794.9/1100000: 78% mana | 1.0/5: 20% soul_shard
6:13.268 incinerate Fluffy_Pillow 810407.3/1100000: 74% mana | 1.0/5: 20% soul_shard
6:14.923 conflagrate Fluffy_Pillow 766019.7/1100000: 70% mana | 1.0/5: 20% soul_shard
6:16.191 chaos_bolt Fluffy_Pillow 760578.3/1100000: 69% mana | 3.0/5: 60% soul_shard backdraft
6:17.668 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
6:18.828 immolate Fluffy_Pillow 1034065.3/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
6:20.095 incinerate Fluffy_Pillow 984610.9/1100000: 90% mana | 1.0/5: 20% soul_shard
6:21.749 incinerate Fluffy_Pillow 940210.2/1100000: 85% mana | 1.0/5: 20% soul_shard
6:23.404 incinerate Fluffy_Pillow 895822.6/1100000: 81% mana | 1.0/5: 20% soul_shard
6:25.058 conflagrate Fluffy_Pillow 851422.0/1100000: 77% mana | 1.0/5: 20% soul_shard
6:26.326 chaos_bolt Fluffy_Pillow 845980.6/1100000: 77% mana | 3.0/5: 60% soul_shard backdraft
6:27.804 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
6:28.965 incinerate Fluffy_Pillow 1034078.4/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft
6:30.124 incinerate Fluffy_Pillow 983213.6/1100000: 89% mana | 1.0/5: 20% soul_shard
6:31.778 incinerate Fluffy_Pillow 938812.9/1100000: 85% mana | 1.0/5: 20% soul_shard
6:33.434 immolate Fluffy_Pillow 894438.4/1100000: 81% mana | 1.0/5: 20% soul_shard
6:34.701 conflagrate Fluffy_Pillow 844984.0/1100000: 77% mana | 1.0/5: 20% soul_shard
6:36.122 chaos_bolt Fluffy_Pillow 841540.6/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft
6:37.600 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft
6:38.758 chaos_bolt Fluffy_Pillow 1034039.2/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft
6:40.236 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
6:41.505 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
6:43.615 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
6:43.615 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
6:45.269 conflagrate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
6:46.536 incinerate Fluffy_Pillow 1028597.8/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
6:47.694 incinerate Fluffy_Pillow 977720.0/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
6:48.851 incinerate Fluffy_Pillow 926829.1/1100000: 84% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
6:50.010 dimensional_rift Fluffy_Pillow 875964.3/1100000: 80% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
6:51.279 immolate Fluffy_Pillow 892536.0/1100000: 81% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
6:52.546 incinerate Fluffy_Pillow 843081.6/1100000: 77% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
6:54.202 chaos_bolt Fluffy_Pillow 798707.0/1100000: 73% mana | 2.0/5: 40% soul_shard potion_of_deadly_grace
6:56.311 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard potion_of_deadly_grace
6:57.580 incinerate Fluffy_Pillow 1094571.7/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
6:58.741 incinerate Fluffy_Pillow 1034078.4/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
6:59.898 incinerate Fluffy_Pillow 983187.5/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, potion_of_deadly_grace
7:01.057 incinerate Fluffy_Pillow 932322.7/1100000: 85% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
7:02.712 incinerate Fluffy_Pillow 887935.1/1100000: 81% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
7:04.367 dimensional_rift Fluffy_Pillow 843547.5/1100000: 77% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
7:05.634 conflagrate Fluffy_Pillow 860093.1/1100000: 78% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
7:06.902 chaos_bolt Fluffy_Pillow 854651.7/1100000: 78% mana | 2.0/5: 40% soul_shard backdraft, potion_of_deadly_grace
7:08.380 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, potion_of_deadly_grace
7:09.539 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft
7:10.699 immolate Fluffy_Pillow 983200.5/1100000: 89% mana | 0.0/5: 0% soul_shard
7:11.966 incinerate Fluffy_Pillow 933746.1/1100000: 85% mana | 0.0/5: 0% soul_shard
7:13.621 dimensional_rift Fluffy_Pillow 889358.5/1100000: 81% mana | 0.0/5: 0% soul_shard
7:14.889 incinerate Fluffy_Pillow 905917.1/1100000: 82% mana | 0.0/5: 0% soul_shard
7:16.547 conflagrate Fluffy_Pillow 861568.7/1100000: 78% mana | 0.0/5: 0% soul_shard
7:17.814 incinerate Fluffy_Pillow 856114.3/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft
7:18.975 chaos_bolt Fluffy_Pillow 805275.7/1100000: 73% mana | 2.0/5: 40% soul_shard backdraft
7:20.454 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft
7:21.613 incinerate Fluffy_Pillow 1034052.2/1100000: 94% mana | 0.0/5: 0% soul_shard
7:23.267 incinerate Fluffy_Pillow 989651.6/1100000: 90% mana | 0.0/5: 0% soul_shard
7:24.921 incinerate Fluffy_Pillow 945250.9/1100000: 86% mana | 0.0/5: 0% soul_shard
7:26.576 conflagrate Fluffy_Pillow 900863.4/1100000: 82% mana | 0.0/5: 0% soul_shard
7:27.843 incinerate Fluffy_Pillow 895408.9/1100000: 81% mana | 1.0/5: 20% soul_shard backdraft
7:29.002 incinerate Fluffy_Pillow 844544.2/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft
7:30.162 immolate Fluffy_Pillow 793692.4/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft
7:31.430 dimensional_rift Fluffy_Pillow 744251.1/1100000: 68% mana | 2.0/5: 40% soul_shard
7:32.698 chaos_bolt Fluffy_Pillow 760809.7/1100000: 69% mana | 2.0/5: 40% soul_shard

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 29107 29107 18408
Intellect 30540 28834 20134 (729)
Spirit 0 0 0
Health 1746420 1746420 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 30540 28834 0
Crit 20.51% 20.51% 5429
Haste 18.72% 17.54% 5701
Damage / Heal Versatility 0.69% 0.69% 274
ManaReg per Second 13059 12930 0
Mastery 83.58% 83.58% 6951
Armor 1591 1591 1591
Run Speed 7 0 303

Gear

Source Slot Average Item Level: 843.00
Local Head Terrorweave Cowl
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +848 Crit, +456 Haste }
Local Neck Pendant of the Watchful Eye
ilevel: 840, stats: { +997 Sta, +1163 Haste, +606 Crit }, enchant: { +75 Crit }
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 840, stats: { 188 Armor, +886 Int, +1329 Sta, +592 Mastery, +350 Crit }
Local Chest Ravencourt Formal Robes
ilevel: 840, stats: { 251 Armor, +1182 Int, +1773 Sta, +791 Mastery, +467 Crit }, gems: { +35 Mastery }
Local Waist Netherwhisper Cinch
ilevel: 840, stats: { 141 Armor, +886 Int, +1329 Sta, +674 Crit, +269 Vers }
Local Legs Rising Ocean Legwraps
ilevel: 855, stats: { 232 Armor, +1359 Int, +2039 Sta, +779 Mastery, +551 Crit }
Local Feet Cushioned Treads of Glory
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +594 Mastery, +385 Haste }
Local Wrists Split-Vein Bracers
ilevel: 840, stats: { 110 Armor, +665 Int, +997 Sta, +414 Haste, +293 Mastery, +303 RunSpeed }
Local Hands Felblaze Handwraps
ilevel: 825, stats: { 149 Armor, +771 Int, +1157 Sta, +599 Crit, +293 Haste }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 860, stats: { +1201 Sta, +1035 Haste, +871 Mastery }, enchant: { +150 Haste }
Local Finger2 Demar's Band of Amore
ilevel: 835, stats: { +952 Sta, +1737 Mastery }, enchant: { +150 Haste }
Local Trinket1 Stolen Mana Crystal
ilevel: 830, stats: { +1023 Int, +865 Crit }
Local Trinket2 Bloom of New Growth
ilevel: 830, stats: { +1023 Int, +865 Haste }
Local Back Drape of Vile Misfortune
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +445 Mastery, +288 Crit }, enchant: { +150 Int }
Local Main Hand Scepter of Sargeras
ilevel: 860, weapon: { 3682 - 5525, 3.6 }, stats: { +1424 Int, +2136 Sta, +678 Haste, +678 Mastery, +7766 Int }, relics: { +35 ilevels, +39 ilevels, +36 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Cataclysm (Destruction Warlock) Mana Tap
45 Demon Skin Mortal Coil Shadowfury
60 Eradication (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demonic Circle Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Dèmonos"
origin="https://eu.api.battle.net/wow/character/hyjal/Dèmonos/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/26/121914138-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=tailoring=19/enchanting=618
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!0001212
artifact=38:0:0:0:0:803:1:804:3:805:3:807:3:808:3:811:3:814:1:816:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/chaos_bolt,if=soul_shard>3|buff.backdraft.remains
actions+=/chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
actions+=/incinerate,if=buff.backdraft.remains
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
actions+=/chaos_bolt
actions+=/cataclysm
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/life_tap,if=talent.mana_tap.enabled&mana.pct<=10
actions+=/incinerate
actions+=/life_tap

head=terrorweave_cowl,id=121324,bonus_id=3432/1512/3337
neck=pendant_of_the_watchful_eye,id=137536,bonus_id=1726/1492/3337,enchant=75crit
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=1727/1492/1813
back=drape_of_vile_misfortune,id=137530,bonus_id=1727/1502/3336,enchant=150int
chest=ravencourt_formal_robes,id=139246,bonus_id=1727/1808/1492/1813,gems=35mastery
wrists=splitvein_bracers,id=137434,bonus_id=1727/42/1492/1813
hands=felblaze_handwraps,id=139903
waist=netherwhisper_cinch,id=134391,bonus_id=1727/1502/1813
legs=rising_ocean_legwraps,id=134428,bonus_id=1727/1507/3337
feet=cushioned_treads_of_glory,id=136774,bonus_id=1727/1502/3336
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1482/3336,enchant=150haste
finger2=demars_band_of_amore,id=141581,bonus_id=1497,enchant=150haste
trinket1=stolen_mana_crystal,id=134336,bonus_id=3397/603/1492/1675
trinket2=bloom_of_new_growth,id=139076,bonus_id=3397/604/1492/1675
main_hand=scepter_of_sargeras,id=128941,bonus_id=749,gem_id=141255/141265/142058/0,relic_id=3395:1482:1675/3397:1497:3336/0/0

# Gear Summary
# gear_ilvl=843.00
# gear_stamina=18408
# gear_intellect=20134
# gear_crit_rating=5323
# gear_haste_rating=5589
# gear_mastery_rating=6815
# gear_versatility_rating=269
# gear_speed_rating=303
# gear_armor=1591
default_pet=imp

Eldiabløød

Eldiabløød : 198346 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
198345.7 198345.7 90.6 / 0.046% 18178.5 / 9.2% 5.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
26405.7 26405.7 Mana 0.00% 38.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Eldiabløød/advanced
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Demon Skin
  • 60: Fire and Brimstone (Destruction Warlock)
  • 75: Dark Pact
  • 90: Grimoire of Service
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • herbalism: 8
  • enchanting: 754

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Eldiabløød 198346
Chaos Bolt 48481 24.5% 47.2 9.35sec 462241 216876 Direct 48.0 0 454877 454877 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.22 47.99 0.00 0.00 2.1314 0.0000 21827257.92 21827257.92 0.00 216875.90 216875.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 47.99 100.00% 454876.61 283573 660503 454916.55 403688 510958 21827258 21827258 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 13120 6.6% 45.0 10.04sec 131144 102767 Direct 45.0 117149 234629 131145 11.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.04 45.04 0.00 0.00 1.2761 0.0000 5906813.55 5906813.55 0.00 102766.51 102766.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.68 88.09% 117149.02 72918 169842 117160.28 103123 133280 4647926 4647926 0.00
crit 5.37 11.91% 234628.62 145835 339676 233577.87 0 334312 1258888 1258888 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 4811 2.4% 22.4 7.05sec 95046 0 Direct 22.4 84960 169921 95045 11.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.44 22.44 0.00 0.00 0.0000 0.0000 2132642.54 2132642.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.77 88.13% 84960.39 84960 84960 84960.39 84960 84960 1680030 1680030 0.00
crit 2.66 11.87% 169920.78 169921 169921 159248.68 0 169921 452612 452612 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 36650 18.5% 29.5 15.38sec 558887 438189 Direct 29.5 77142 154136 92467 19.9%  
Periodic 178.8 64266 128515 77035 19.9% 99.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.53 29.53 178.80 178.80 1.2755 2.4972 16504405.63 16504405.63 0.00 34088.53 438189.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.65 80.10% 77142.22 48017 111843 77138.30 63636 89116 1824674 1824674 0.00
crit 5.88 19.90% 154135.59 96034 223684 153720.19 0 221450 905850 905850 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.3 80.12% 64265.71 26 147899 64282.10 59382 70110 9206979 9206979 0.00
crit 35.5 19.88% 128514.58 54 295800 128546.71 100348 160673 4566903 4566903 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.08
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFF{$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 45162 22.8% 135.7 3.22sec 149945 92912 Direct 135.2 134643 269202 150577 11.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.72 135.15 0.00 0.00 1.6138 0.0000 20350909.88 20350909.88 0.00 92912.10 92912.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.15 88.16% 134642.78 84027 195720 134641.52 123513 146965 16042328 16042328 0.00
crit 16.01 11.84% 269201.69 168055 391438 269225.26 208380 327794 4308582 4308582 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.88
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.remains
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 13096 / 13096
Firebolt 13096 6.6% 135.7 3.32sec 43448 29188 Direct 135.0 39049 78124 43676 11.8%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.71 135.00 0.00 0.00 1.4885 0.0000 5896187.27 5896187.27 0.00 29188.47 29188.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.01 88.16% 39049.13 25378 41661 39049.91 38571 39406 4647369 4647369 0.00
crit 15.99 11.84% 78123.67 50756 83322 78125.75 73151 81885 1248818 1248818 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 37834 / 11539
Firebolt 37834 5.8% 59.3 7.14sec 87579 60505 Direct 59.1 78670 157397 88023 11.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.35 59.05 0.00 0.00 1.4475 0.0000 5197822.42 5197822.42 0.00 60504.52 60504.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.04 88.12% 78670.31 50756 83322 78646.01 77609 79791 4093667 4093667 0.00
crit 7.02 11.88% 157397.17 101512 166645 157149.57 0 166645 1104156 1104156 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - doomguard 28624 / 4523
Doom Bolt 28624 2.3% 28.4 13.41sec 71238 30068 Direct 28.3 63956 127907 71512 11.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.43 28.33 0.00 0.00 2.3693 0.0000 2025604.46 2025604.46 0.00 30067.75 30067.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.98 88.18% 63956.30 58801 77224 63865.87 60568 68759 1597493 1597493 0.00
crit 3.35 11.82% 127907.45 117603 154448 124100.90 0 154448 428112 428112 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - shadowy_tear 49399 / 8475
Shadow Bolt 49399 4.3% 6.4 66.45sec 591500 0 Periodic 53.7 63382 126760 70849 11.8% 19.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.43 0.00 53.93 53.72 0.0000 1.6367 3805890.30 3805890.30 0.00 43116.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.4 88.22% 63381.99 5264 67740 63371.14 0 67740 3003788 3003788 0.00
crit 6.3 11.78% 126760.23 10529 135481 125457.57 0 135481 802102 802102 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 74182 / 5040
Chaos Bolt 74182 2.5% 6.4 65.39sec 356379 140216 Direct 6.3 0 358097 358097 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.36 6.33 0.00 0.00 2.5416 0.0000 2266031.12 2266031.12 0.00 140216.02 140216.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 6.33 100.00% 358096.80 346217 378907 358138.46 0 378907 2266031 2266031 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 109440 / 7463
Chaos Barrage 109440 3.8% 6.4 65.98sec 520516 0 Periodic 173.7 17255 34514 19306 11.9% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.44 0.00 174.31 173.73 0.0000 0.2016 3354085.91 3354085.91 0.00 95460.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.1 88.12% 17255.40 2499 18629 17252.29 16332 18629 2641619 2641619 0.00
crit 20.6 11.88% 34514.14 2186 37259 34505.51 0 37259 712467 712467 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Eldiabløød
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
Dimensional Rift 19.3 24.70sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.28 0.00 0.00 0.00 1.2757 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Eldiabløød
  • harmful:false
  • if_expr:
 
Life Tap 0.0 0.00sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.3164 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mana_tap.enabled&mana.pct<=10
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 5.2 94.04sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.24 0.00 0.00 0.00 1.2587 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Summon Doomguard 2.9 183.44sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 1.2124 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.42% 0.0(0.0) 1.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 122.3sec 0.0sec 10.83% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Valarjar's Path 4.3 0.0 120.6sec 120.6sec 27.58% 27.64% 0.0(0.0) 4.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_valarjars_path
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:2696.40

Stack Uptimes

  • valarjars_path_1:27.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215956
  • name:Valarjar's Path
  • tooltip:Primary stat increased by {$s4=2039}.
  • description:Sound the horn, increasing your primary stat by {$215956s1=2039} for {$215956d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Eldiabløød
chaos_bolt Soul Shard 48.2 96.4 2.0 2.0 226331.1
conflagrate Mana 45.0 990897.0 22000.0 22000.0 6.0
immolate Mana 29.5 1949008.3 66000.0 65999.1 8.5
incinerate Mana 135.7 8957796.7 66000.0 66000.7 2.3
service_imp Soul Shard 5.2 5.2 1.0 1.0 0.0
summon_doomguard Soul Shard 2.9 2.9 1.0 1.0 0.0
pet - imp
firebolt Energy 135.7 5428.3 40.0 40.0 1086.2
pet - service_imp
firebolt Energy 59.3 2374.0 40.0 40.0 2189.5
pet - doomguard
doom_bolt Energy 28.4 995.2 35.0 35.0 2035.3
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 32.09 32.02 (31.13%) 1.00 0.07 0.23%
conflagrate Soul Shard 45.04 45.02 (43.77%) 1.00 0.02 0.05%
life_tap Mana 0.00 923.35 (0.01%) 330000.00 0.00 0.00%
mp5_regen Mana 512.48 4826710.50 (41.10%) 9418.30 989402.91 17.01%
soul_conduit Soul Shard 20.99 20.99 (20.41%) 1.00 0.00 0.00%
reverse_entropy Mana 48.22 6916707.11 (58.89%) 143441.38 11647895.17 62.74%
soulsnatcher Soul Shard 4.83 4.83 (4.69%) 1.00 0.00 0.06%
pet - imp
energy_regen Energy 2753.39 5262.35 (100.00%) 1.91 22.74 0.43%
pet - service_imp
energy_regen Energy 535.42 1526.89 (100.00%) 2.85 91.35 5.65%
pet - doomguard
energy_regen Energy 28.44 894.05 (100.00%) 31.44 129.51 12.65%
Resource RPS-Gain RPS-Loss
Health 1.11 1.12
Mana 26065.12 26405.66
Soul Shard 0.23 0.23
Combat End Resource Mean Min Max
Mana 946256.29 326383.57 1100000.00
Soul Shard 1.24 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 16.0%

Procs

Count Interval
shadowy_tear 6.4 65.0sec
chaos_tear 6.4 64.7sec
chaos_portal 6.4 64.6sec
dimension_ripper 6.8 55.5sec
soul_conduit 21.0 22.8sec

Statistics & Data Analysis

Fight Length
Sample Data Eldiabløød Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Eldiabløød Damage Per Second
Count 9999
Mean 198345.72
Minimum 180966.22
Maximum 219607.29
Spread ( max - min ) 38641.07
Range [ ( max - min ) / 2 * 100% ] 9.74%
Standard Deviation 4621.9915
5th Percentile 191063.61
95th Percentile 206253.02
( 95th Percentile - 5th Percentile ) 15189.41
Mean Distribution
Standard Deviation 46.2222
95.00% Confidence Intervall ( 198255.13 - 198436.32 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2085
0.1 Scale Factor Error with Delta=300 182365
0.05 Scale Factor Error with Delta=300 729460
0.01 Scale Factor Error with Delta=300 18236519
Priority Target DPS
Sample Data Eldiabløød Priority Target Damage Per Second
Count 9999
Mean 198345.72
Minimum 180966.22
Maximum 219607.29
Spread ( max - min ) 38641.07
Range [ ( max - min ) / 2 * 100% ] 9.74%
Standard Deviation 4621.9915
5th Percentile 191063.61
95th Percentile 206253.02
( 95th Percentile - 5th Percentile ) 15189.41
Mean Distribution
Standard Deviation 46.2222
95.00% Confidence Intervall ( 198255.13 - 198436.32 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2085
0.1 Scale Factor Error with Delta=300 182365
0.05 Scale Factor Error with Delta=300 729460
0.01 Scale Factor Error with Delta=300 18236519
DPS(e)
Sample Data Eldiabløød Damage Per Second (Effective)
Count 9999
Mean 198345.72
Minimum 180966.22
Maximum 219607.29
Spread ( max - min ) 38641.07
Range [ ( max - min ) / 2 * 100% ] 9.74%
Damage
Sample Data Eldiabløød Damage
Count 9999
Mean 66722029.52
Minimum 49655331.63
Maximum 86722700.00
Spread ( max - min ) 37067368.37
Range [ ( max - min ) / 2 * 100% ] 27.78%
DTPS
Sample Data Eldiabløød Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Eldiabløød Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Eldiabløød Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Eldiabløød Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Eldiabløød Healing Taken Per Second
Count 9999
Mean 1.07
Minimum 0.00
Maximum 477.84
Spread ( max - min ) 477.84
Range [ ( max - min ) / 2 * 100% ] 22305.71%
TMI
Sample Data Eldiabløød Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data EldiabløødTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Eldiabløød Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 potion,name=deadly_grace
A 0.00 mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 4.31 use_item,name=horn_of_valor
0.00 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
0.00 havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
D 1.00 dimensional_rift,if=charges=3
E 15.37 immolate,if=remains<=tick_time
0.00 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
F 14.27 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
H 16.56 conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
I 13.90 conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
J 13.59 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
K 1.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 5.24 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
M 2.91 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
N 3.77 chaos_bolt,if=soul_shard>3|buff.backdraft.remains
0.00 chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
0.00 incinerate,if=buff.backdraft.remains
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
O 18.28 dimensional_rift
0.00 mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
P 43.68 chaos_bolt
0.00 cataclysm
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
0.00 life_tap,if=talent.mana_tap.enabled&mana.pct<=10
Q 136.18 incinerate
R 0.00 life_tap

Sample Sequence

01269BCDEFHILMOOQQJPQQQQKPQQEQPQQQQFHIPPQQQJOQQQQQEOPQQFHIPNPQJPPQQQEQQOQFHILPQOQQJPPQPEPCQGQQFHINPQOQJPQQQQEPQQQFHINPQQQJPQQQQEOQQMQFHILPQOQJQPQPQEQPQQFHINOPQQJQQQQCQEPQQQFHIPPQQQJPQOQQEQQQQQFHILPQQQJPQQQQEQOQOQFHIOPQPQJQQPQQEQQQQFHIOPQQQJOCPQQQEQQQQQFHILMQQQQJQQQQQEOQOQQFHPQQQQHIPQPQQEHPQQQHQQQOEQ

Sample Sequence Table

time name target resources buffs
Pre flask Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Eldiabløød 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.000 use_item_horn_of_valor Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.000 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
0:01.243 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:02.257 immolate Fluffy_Pillow 1034081.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:03.272 conflagrate Fluffy_Pillow 984668.4/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:04.285 conflagrate Fluffy_Pillow 979222.5/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:05.298 service_imp Fluffy_Pillow 973776.5/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:06.313 summon_doomguard Fluffy_Pillow 990363.2/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:07.328 dimensional_rift Fluffy_Pillow 1006950.0/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:08.341 dimensional_rift Fluffy_Pillow 1023504.0/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:09.354 incinerate Fluffy_Pillow 1040058.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:10.622 incinerate Fluffy_Pillow 994779.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:11.891 conflagrate Fluffy_Pillow 949516.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:12.904 chaos_bolt Fluffy_Pillow 944070.7/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:14.589 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:15.859 incinerate Fluffy_Pillow 1034081.7/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:17.128 incinerate Fluffy_Pillow 988819.2/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:18.396 incinerate Fluffy_Pillow 943540.3/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:19.667 conflagrate Fluffy_Pillow 898310.5/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:20.683 chaos_bolt Fluffy_Pillow 892913.6/1100000: 81% mana | 3.0/5: 60% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:22.370 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path, potion_of_deadly_grace
0:23.638 incinerate Fluffy_Pillow 1034049.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:24.908 immolate Fluffy_Pillow 988802.9/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:25.921 incinerate Fluffy_Pillow 939356.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, valarjars_path
0:27.190 chaos_bolt Fluffy_Pillow 894094.4/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, valarjars_path
0:28.876 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, valarjars_path
0:30.146 incinerate Fluffy_Pillow 1034081.7/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust
0:31.415 incinerate Fluffy_Pillow 988819.2/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust
0:32.685 incinerate Fluffy_Pillow 943573.0/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust
0:33.955 immolate Fluffy_Pillow 898326.9/1100000: 82% mana | 0.0/5: 0% soul_shard bloodlust
0:34.970 conflagrate Fluffy_Pillow 848913.6/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust
0:35.984 conflagrate Fluffy_Pillow 843484.0/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust
0:36.997 chaos_bolt Fluffy_Pillow 838038.0/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust
0:38.684 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust
0:40.371 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust
0:41.642 incinerate Fluffy_Pillow 1034075.4/1100000: 94% mana | 0.0/5: 0% soul_shard
0:43.291 incinerate Fluffy_Pillow 988804.1/1100000: 90% mana | 0.0/5: 0% soul_shard
0:44.940 conflagrate Fluffy_Pillow 943532.8/1100000: 86% mana | 0.0/5: 0% soul_shard
0:46.257 dimensional_rift Fluffy_Pillow 938088.1/1100000: 85% mana | 1.0/5: 20% soul_shard
0:47.574 incinerate Fluffy_Pillow 954643.4/1100000: 87% mana | 1.0/5: 20% soul_shard
0:49.224 incinerate Fluffy_Pillow 909384.7/1100000: 83% mana | 1.0/5: 20% soul_shard
0:50.874 incinerate Fluffy_Pillow 864125.9/1100000: 79% mana | 1.0/5: 20% soul_shard
0:52.523 incinerate Fluffy_Pillow 818854.6/1100000: 74% mana | 1.0/5: 20% soul_shard
0:54.173 incinerate Fluffy_Pillow 773595.9/1100000: 70% mana | 1.0/5: 20% soul_shard
0:55.823 immolate Fluffy_Pillow 728337.1/1100000: 66% mana | 2.0/5: 40% soul_shard
0:57.138 dimensional_rift Fluffy_Pillow 678867.3/1100000: 62% mana | 2.0/5: 40% soul_shard
0:58.455 chaos_bolt Fluffy_Pillow 695422.6/1100000: 63% mana | 3.0/5: 60% soul_shard
1:00.647 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:02.296 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 1.0/5: 20% soul_shard
1:03.944 immolate Fluffy_Pillow 988766.4/1100000: 90% mana | 1.0/5: 20% soul_shard
1:05.261 conflagrate Fluffy_Pillow 939321.7/1100000: 85% mana | 1.0/5: 20% soul_shard
1:06.575 conflagrate Fluffy_Pillow 933839.3/1100000: 85% mana | 2.0/5: 40% soul_shard
1:07.892 chaos_bolt Fluffy_Pillow 928394.6/1100000: 84% mana | 3.0/5: 60% soul_shard
1:10.085 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard
1:12.278 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
1:14.471 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:16.122 conflagrate Fluffy_Pillow 1034075.4/1100000: 94% mana | 1.0/5: 20% soul_shard
1:17.440 chaos_bolt Fluffy_Pillow 1028643.3/1100000: 94% mana | 3.0/5: 60% soul_shard
1:19.629 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
1:21.821 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
1:23.470 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 1.0/5: 20% soul_shard
1:25.119 incinerate Fluffy_Pillow 988779.0/1100000: 90% mana | 1.0/5: 20% soul_shard
1:26.769 immolate Fluffy_Pillow 943520.2/1100000: 86% mana | 1.0/5: 20% soul_shard
1:28.086 incinerate Fluffy_Pillow 894075.5/1100000: 81% mana | 1.0/5: 20% soul_shard
1:29.735 incinerate Fluffy_Pillow 848804.2/1100000: 77% mana | 1.0/5: 20% soul_shard
1:31.382 dimensional_rift Fluffy_Pillow 803507.8/1100000: 73% mana | 1.0/5: 20% soul_shard
1:32.700 incinerate Fluffy_Pillow 820075.6/1100000: 75% mana | 1.0/5: 20% soul_shard
1:34.349 immolate Fluffy_Pillow 774804.3/1100000: 70% mana | 2.0/5: 40% soul_shard
1:35.666 conflagrate Fluffy_Pillow 725359.6/1100000: 66% mana | 2.0/5: 40% soul_shard
1:36.982 conflagrate Fluffy_Pillow 719902.4/1100000: 65% mana | 3.0/5: 60% soul_shard
1:38.298 service_imp Fluffy_Pillow 714445.1/1100000: 65% mana | 4.0/5: 80% soul_shard
1:39.613 chaos_bolt Fluffy_Pillow 730975.2/1100000: 66% mana | 3.0/5: 60% soul_shard
1:41.804 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:43.453 dimensional_rift Fluffy_Pillow 1034050.3/1100000: 94% mana | 1.0/5: 20% soul_shard
1:44.772 incinerate Fluffy_Pillow 1050630.7/1100000: 96% mana | 1.0/5: 20% soul_shard
1:46.423 incinerate Fluffy_Pillow 1005384.6/1100000: 91% mana | 1.0/5: 20% soul_shard
1:48.074 conflagrate Fluffy_Pillow 960138.4/1100000: 87% mana | 1.0/5: 20% soul_shard
1:49.392 chaos_bolt Fluffy_Pillow 954706.3/1100000: 87% mana | 2.0/5: 40% soul_shard
1:51.584 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
1:53.775 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
1:55.425 chaos_bolt Fluffy_Pillow 1034062.9/1100000: 94% mana | 2.0/5: 40% soul_shard
1:57.617 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
1:58.934 chaos_bolt Fluffy_Pillow 1034062.9/1100000: 94% mana | 2.0/5: 40% soul_shard
2:01.126 use_item_horn_of_valor Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
2:01.126 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path
2:02.775 potion Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path
2:02.775 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path, potion_of_deadly_grace
2:04.425 incinerate Fluffy_Pillow 988791.5/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:06.073 immolate Fluffy_Pillow 943507.7/1100000: 86% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:07.389 conflagrate Fluffy_Pillow 894050.4/1100000: 81% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:08.706 conflagrate Fluffy_Pillow 888605.7/1100000: 81% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:10.023 chaos_bolt Fluffy_Pillow 883161.0/1100000: 80% mana | 4.0/5: 80% soul_shard valarjars_path, potion_of_deadly_grace
2:12.214 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:14.405 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:16.052 dimensional_rift Fluffy_Pillow 1034025.1/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:17.368 incinerate Fluffy_Pillow 1050567.9/1100000: 96% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:19.017 conflagrate Fluffy_Pillow 1005296.6/1100000: 91% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:20.335 chaos_bolt Fluffy_Pillow 999864.4/1100000: 91% mana | 2.0/5: 40% soul_shard valarjars_path, potion_of_deadly_grace
2:22.527 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path, potion_of_deadly_grace
2:24.176 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path, potion_of_deadly_grace
2:25.825 incinerate Fluffy_Pillow 988779.0/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:27.475 incinerate Fluffy_Pillow 943520.2/1100000: 86% mana | 1.0/5: 20% soul_shard valarjars_path, potion_of_deadly_grace
2:29.126 immolate Fluffy_Pillow 898274.1/1100000: 82% mana | 2.0/5: 40% soul_shard valarjars_path
2:30.443 chaos_bolt Fluffy_Pillow 848829.4/1100000: 77% mana | 2.0/5: 40% soul_shard valarjars_path
2:32.636 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
2:34.285 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard
2:35.935 incinerate Fluffy_Pillow 988791.5/1100000: 90% mana | 0.0/5: 0% soul_shard
2:37.584 immolate Fluffy_Pillow 943520.2/1100000: 86% mana | 0.0/5: 0% soul_shard
2:38.901 conflagrate Fluffy_Pillow 894075.5/1100000: 81% mana | 1.0/5: 20% soul_shard
2:40.219 conflagrate Fluffy_Pillow 888643.4/1100000: 81% mana | 2.0/5: 40% soul_shard
2:41.537 chaos_bolt Fluffy_Pillow 883211.3/1100000: 80% mana | 4.0/5: 80% soul_shard
2:43.730 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
2:45.922 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
2:47.570 incinerate Fluffy_Pillow 1034037.7/1100000: 94% mana | 1.0/5: 20% soul_shard
2:49.218 incinerate Fluffy_Pillow 988753.8/1100000: 90% mana | 1.0/5: 20% soul_shard
2:50.867 conflagrate Fluffy_Pillow 943482.5/1100000: 86% mana | 1.0/5: 20% soul_shard
2:52.182 chaos_bolt Fluffy_Pillow 938012.7/1100000: 85% mana | 2.0/5: 40% soul_shard
2:54.374 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
2:56.023 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard
2:57.672 incinerate Fluffy_Pillow 988779.0/1100000: 90% mana | 0.0/5: 0% soul_shard
2:59.322 incinerate Fluffy_Pillow 943520.2/1100000: 86% mana | 0.0/5: 0% soul_shard
3:00.971 immolate Fluffy_Pillow 898248.9/1100000: 82% mana | 1.0/5: 20% soul_shard
3:02.290 dimensional_rift Fluffy_Pillow 848829.4/1100000: 77% mana | 1.0/5: 20% soul_shard
3:03.609 incinerate Fluffy_Pillow 865409.8/1100000: 79% mana | 1.0/5: 20% soul_shard
3:05.258 incinerate Fluffy_Pillow 820138.5/1100000: 75% mana | 1.0/5: 20% soul_shard
3:06.908 summon_doomguard Fluffy_Pillow 774879.8/1100000: 70% mana | 1.0/5: 20% soul_shard
3:08.224 incinerate Fluffy_Pillow 791422.5/1100000: 72% mana | 0.0/5: 0% soul_shard
3:09.875 immolate Fluffy_Pillow 746176.3/1100000: 68% mana | 0.0/5: 0% soul_shard
3:11.190 conflagrate Fluffy_Pillow 696706.5/1100000: 63% mana | 0.0/5: 0% soul_shard
3:12.505 conflagrate Fluffy_Pillow 691236.6/1100000: 63% mana | 1.0/5: 20% soul_shard
3:13.821 service_imp Fluffy_Pillow 685779.4/1100000: 62% mana | 2.0/5: 40% soul_shard
3:15.140 chaos_bolt Fluffy_Pillow 702359.8/1100000: 64% mana | 2.0/5: 40% soul_shard
3:17.332 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:18.981 dimensional_rift Fluffy_Pillow 1034050.3/1100000: 94% mana | 0.0/5: 0% soul_shard
3:20.298 incinerate Fluffy_Pillow 1050605.6/1100000: 96% mana | 0.0/5: 0% soul_shard
3:21.947 conflagrate Fluffy_Pillow 1005334.3/1100000: 91% mana | 0.0/5: 0% soul_shard
3:23.271 incinerate Fluffy_Pillow 999977.6/1100000: 91% mana | 1.0/5: 20% soul_shard
3:24.920 chaos_bolt Fluffy_Pillow 954706.3/1100000: 87% mana | 2.0/5: 40% soul_shard
3:27.111 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:28.760 chaos_bolt Fluffy_Pillow 1034050.3/1100000: 94% mana | 2.0/5: 40% soul_shard
3:30.952 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:32.600 immolate Fluffy_Pillow 1034037.7/1100000: 94% mana | 1.0/5: 20% soul_shard
3:33.917 incinerate Fluffy_Pillow 984593.0/1100000: 90% mana | 1.0/5: 20% soul_shard
3:35.565 chaos_bolt Fluffy_Pillow 939309.1/1100000: 85% mana | 2.0/5: 40% soul_shard
3:37.758 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
3:39.406 incinerate Fluffy_Pillow 1034037.7/1100000: 94% mana | 1.0/5: 20% soul_shard
3:41.057 immolate Fluffy_Pillow 988791.5/1100000: 90% mana | 2.0/5: 40% soul_shard
3:42.374 conflagrate Fluffy_Pillow 939346.8/1100000: 85% mana | 2.0/5: 40% soul_shard
3:43.690 conflagrate Fluffy_Pillow 933889.6/1100000: 85% mana | 3.0/5: 60% soul_shard
3:45.005 chaos_bolt Fluffy_Pillow 928419.7/1100000: 84% mana | 4.0/5: 80% soul_shard
3:47.198 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
3:48.515 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard
3:50.706 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
3:52.356 incinerate Fluffy_Pillow 1034062.9/1100000: 94% mana | 0.0/5: 0% soul_shard
3:54.006 conflagrate Fluffy_Pillow 988804.1/1100000: 90% mana | 0.0/5: 0% soul_shard
3:55.323 incinerate Fluffy_Pillow 983359.4/1100000: 89% mana | 1.0/5: 20% soul_shard
3:56.973 incinerate Fluffy_Pillow 938100.7/1100000: 85% mana | 1.0/5: 20% soul_shard
3:58.621 incinerate Fluffy_Pillow 892816.8/1100000: 81% mana | 1.0/5: 20% soul_shard
4:00.271 incinerate Fluffy_Pillow 847558.1/1100000: 77% mana | 1.0/5: 20% soul_shard
4:01.922 use_item_horn_of_valor Fluffy_Pillow 802311.9/1100000: 73% mana | 1.0/5: 20% soul_shard
4:01.922 incinerate Fluffy_Pillow 802311.9/1100000: 73% mana | 1.0/5: 20% soul_shard valarjars_path
4:03.572 immolate Fluffy_Pillow 757053.1/1100000: 69% mana | 2.0/5: 40% soul_shard valarjars_path
4:04.887 chaos_bolt Fluffy_Pillow 707583.3/1100000: 64% mana | 2.0/5: 40% soul_shard valarjars_path
4:07.079 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path
4:08.727 incinerate Fluffy_Pillow 1034037.7/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path
4:10.378 incinerate Fluffy_Pillow 988791.5/1100000: 90% mana | 0.0/5: 0% soul_shard valarjars_path
4:12.028 immolate Fluffy_Pillow 943532.8/1100000: 86% mana | 0.0/5: 0% soul_shard valarjars_path
4:13.345 conflagrate Fluffy_Pillow 894088.1/1100000: 81% mana | 0.0/5: 0% soul_shard valarjars_path
4:14.661 conflagrate Fluffy_Pillow 888630.8/1100000: 81% mana | 1.0/5: 20% soul_shard valarjars_path
4:15.978 chaos_bolt Fluffy_Pillow 883186.1/1100000: 80% mana | 2.0/5: 40% soul_shard valarjars_path
4:18.169 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard valarjars_path
4:20.363 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard valarjars_path
4:22.013 incinerate Fluffy_Pillow 1034062.9/1100000: 94% mana | 1.0/5: 20% soul_shard valarjars_path
4:23.663 incinerate Fluffy_Pillow 988804.1/1100000: 90% mana | 1.0/5: 20% soul_shard valarjars_path
4:25.313 conflagrate Fluffy_Pillow 943545.4/1100000: 86% mana | 1.0/5: 20% soul_shard valarjars_path
4:26.630 chaos_bolt Fluffy_Pillow 938100.7/1100000: 85% mana | 2.0/5: 40% soul_shard valarjars_path
4:28.821 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path
4:30.471 dimensional_rift Fluffy_Pillow 1034062.9/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path
4:31.788 incinerate Fluffy_Pillow 1050618.2/1100000: 96% mana | 0.0/5: 0% soul_shard valarjars_path
4:33.440 incinerate Fluffy_Pillow 1005384.6/1100000: 91% mana | 1.0/5: 20% soul_shard
4:35.088 immolate Fluffy_Pillow 960100.7/1100000: 87% mana | 1.0/5: 20% soul_shard
4:36.404 incinerate Fluffy_Pillow 910643.4/1100000: 83% mana | 1.0/5: 20% soul_shard
4:38.054 incinerate Fluffy_Pillow 865384.7/1100000: 79% mana | 1.0/5: 20% soul_shard
4:39.704 incinerate Fluffy_Pillow 820125.9/1100000: 75% mana | 1.0/5: 20% soul_shard
4:41.356 incinerate Fluffy_Pillow 774892.3/1100000: 70% mana | 1.0/5: 20% soul_shard
4:43.005 incinerate Fluffy_Pillow 729621.0/1100000: 66% mana | 1.0/5: 20% soul_shard
4:44.655 immolate Fluffy_Pillow 684362.3/1100000: 62% mana | 1.0/5: 20% soul_shard
4:45.973 conflagrate Fluffy_Pillow 634930.1/1100000: 58% mana | 1.0/5: 20% soul_shard
4:47.290 conflagrate Fluffy_Pillow 629485.4/1100000: 57% mana | 2.0/5: 40% soul_shard
4:48.607 service_imp Fluffy_Pillow 624040.7/1100000: 57% mana | 3.0/5: 60% soul_shard
4:49.923 chaos_bolt Fluffy_Pillow 640583.5/1100000: 58% mana | 2.0/5: 40% soul_shard
4:52.114 incinerate Fluffy_Pillow 1053125.4/1100000: 96% mana | 0.0/5: 0% soul_shard
4:53.765 incinerate Fluffy_Pillow 1007879.2/1100000: 92% mana | 0.0/5: 0% soul_shard
4:55.414 incinerate Fluffy_Pillow 962607.9/1100000: 88% mana | 1.0/5: 20% soul_shard
4:57.064 conflagrate Fluffy_Pillow 917349.1/1100000: 83% mana | 1.0/5: 20% soul_shard
4:58.380 chaos_bolt Fluffy_Pillow 911891.9/1100000: 83% mana | 2.0/5: 40% soul_shard
5:00.569 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:02.219 incinerate Fluffy_Pillow 1034062.9/1100000: 94% mana | 1.0/5: 20% soul_shard
5:03.869 incinerate Fluffy_Pillow 988804.1/1100000: 90% mana | 1.0/5: 20% soul_shard
5:05.518 incinerate Fluffy_Pillow 943532.8/1100000: 86% mana | 1.0/5: 20% soul_shard
5:07.166 immolate Fluffy_Pillow 898248.9/1100000: 82% mana | 1.0/5: 20% soul_shard
5:08.484 incinerate Fluffy_Pillow 848816.8/1100000: 77% mana | 1.0/5: 20% soul_shard
5:10.134 dimensional_rift Fluffy_Pillow 803558.1/1100000: 73% mana | 1.0/5: 20% soul_shard
5:11.450 incinerate Fluffy_Pillow 820100.8/1100000: 75% mana | 1.0/5: 20% soul_shard
5:13.100 dimensional_rift Fluffy_Pillow 774842.0/1100000: 70% mana | 1.0/5: 20% soul_shard
5:14.417 incinerate Fluffy_Pillow 791397.3/1100000: 72% mana | 1.0/5: 20% soul_shard
5:16.067 immolate Fluffy_Pillow 746138.6/1100000: 68% mana | 1.0/5: 20% soul_shard
5:17.385 conflagrate Fluffy_Pillow 696706.5/1100000: 63% mana | 1.0/5: 20% soul_shard
5:18.700 conflagrate Fluffy_Pillow 691236.6/1100000: 63% mana | 2.0/5: 40% soul_shard
5:20.017 dimensional_rift Fluffy_Pillow 685791.9/1100000: 62% mana | 3.0/5: 60% soul_shard
5:21.333 chaos_bolt Fluffy_Pillow 702334.7/1100000: 64% mana | 3.0/5: 60% soul_shard
5:23.526 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:25.176 chaos_bolt Fluffy_Pillow 1034062.9/1100000: 94% mana | 2.0/5: 40% soul_shard
5:27.369 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
5:29.019 conflagrate Fluffy_Pillow 1034062.9/1100000: 94% mana | 0.0/5: 0% soul_shard
5:30.336 incinerate Fluffy_Pillow 1028618.2/1100000: 94% mana | 1.0/5: 20% soul_shard
5:31.986 incinerate Fluffy_Pillow 983359.4/1100000: 89% mana | 1.0/5: 20% soul_shard
5:33.636 chaos_bolt Fluffy_Pillow 938100.7/1100000: 85% mana | 2.0/5: 40% soul_shard
5:35.828 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
5:37.476 incinerate Fluffy_Pillow 1034037.7/1100000: 94% mana | 0.0/5: 0% soul_shard
5:39.127 immolate Fluffy_Pillow 988791.5/1100000: 90% mana | 0.0/5: 0% soul_shard
5:40.443 incinerate Fluffy_Pillow 939334.3/1100000: 85% mana | 0.0/5: 0% soul_shard
5:42.091 incinerate Fluffy_Pillow 894050.4/1100000: 81% mana | 0.0/5: 0% soul_shard
5:43.742 incinerate Fluffy_Pillow 848804.2/1100000: 77% mana | 1.0/5: 20% soul_shard
5:45.393 incinerate Fluffy_Pillow 803558.1/1100000: 73% mana | 1.0/5: 20% soul_shard
5:47.044 immolate Fluffy_Pillow 758311.9/1100000: 69% mana | 1.0/5: 20% soul_shard
5:48.360 conflagrate Fluffy_Pillow 708854.6/1100000: 64% mana | 1.0/5: 20% soul_shard
5:49.676 conflagrate Fluffy_Pillow 703397.3/1100000: 64% mana | 2.0/5: 40% soul_shard
5:50.992 dimensional_rift Fluffy_Pillow 697940.1/1100000: 63% mana | 3.0/5: 60% soul_shard
5:52.308 chaos_bolt Fluffy_Pillow 714482.8/1100000: 65% mana | 3.0/5: 60% soul_shard
5:54.499 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard
5:56.148 incinerate Fluffy_Pillow 1034050.3/1100000: 94% mana | 1.0/5: 20% soul_shard
5:57.798 incinerate Fluffy_Pillow 988791.5/1100000: 90% mana | 1.0/5: 20% soul_shard
5:59.447 conflagrate Fluffy_Pillow 943520.2/1100000: 86% mana | 1.0/5: 20% soul_shard
6:00.790 dimensional_rift Fluffy_Pillow 938402.4/1100000: 85% mana | 2.0/5: 40% soul_shard
6:02.106 use_item_horn_of_valor Fluffy_Pillow 954945.1/1100000: 87% mana | 2.0/5: 40% soul_shard
6:02.106 chaos_bolt Fluffy_Pillow 954945.1/1100000: 87% mana | 2.0/5: 40% soul_shard valarjars_path
6:04.297 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard valarjars_path
6:05.947 incinerate Fluffy_Pillow 1034062.9/1100000: 94% mana | 0.0/5: 0% soul_shard valarjars_path
6:07.595 incinerate Fluffy_Pillow 988779.0/1100000: 90% mana | 0.0/5: 0% soul_shard valarjars_path
6:09.243 immolate Fluffy_Pillow 943495.1/1100000: 86% mana | 0.0/5: 0% soul_shard valarjars_path
6:10.559 incinerate Fluffy_Pillow 894037.8/1100000: 81% mana | 0.0/5: 0% soul_shard valarjars_path
6:12.208 incinerate Fluffy_Pillow 848766.5/1100000: 77% mana | 0.0/5: 0% soul_shard valarjars_path
6:13.857 incinerate Fluffy_Pillow 803495.2/1100000: 73% mana | 0.0/5: 0% soul_shard valarjars_path
6:15.507 incinerate Fluffy_Pillow 758236.5/1100000: 69% mana | 0.0/5: 0% soul_shard valarjars_path
6:17.157 incinerate Fluffy_Pillow 712977.7/1100000: 65% mana | 0.0/5: 0% soul_shard valarjars_path
6:18.806 immolate Fluffy_Pillow 667706.4/1100000: 61% mana | 0.0/5: 0% soul_shard valarjars_path
6:20.123 conflagrate Fluffy_Pillow 618261.7/1100000: 56% mana | 0.0/5: 0% soul_shard valarjars_path
6:21.439 conflagrate Fluffy_Pillow 612804.4/1100000: 56% mana | 1.0/5: 20% soul_shard valarjars_path
6:22.756 service_imp Fluffy_Pillow 607359.7/1100000: 55% mana | 2.0/5: 40% soul_shard valarjars_path
6:24.072 summon_doomguard Fluffy_Pillow 623902.5/1100000: 57% mana | 1.0/5: 20% soul_shard valarjars_path
6:25.390 incinerate Fluffy_Pillow 640470.3/1100000: 58% mana | 0.0/5: 0% soul_shard valarjars_path
6:27.039 incinerate Fluffy_Pillow 595199.0/1100000: 54% mana | 0.0/5: 0% soul_shard valarjars_path
6:28.688 incinerate Fluffy_Pillow 549927.7/1100000: 50% mana | 0.0/5: 0% soul_shard valarjars_path
6:30.337 incinerate Fluffy_Pillow 504656.4/1100000: 46% mana | 0.0/5: 0% soul_shard valarjars_path
6:31.988 conflagrate Fluffy_Pillow 459410.2/1100000: 42% mana | 0.0/5: 0% soul_shard valarjars_path
6:33.305 incinerate Fluffy_Pillow 453965.5/1100000: 41% mana | 1.0/5: 20% soul_shard
6:34.955 incinerate Fluffy_Pillow 408706.8/1100000: 37% mana | 1.0/5: 20% soul_shard
6:36.604 incinerate Fluffy_Pillow 363435.5/1100000: 33% mana | 1.0/5: 20% soul_shard
6:38.254 incinerate Fluffy_Pillow 318176.8/1100000: 29% mana | 1.0/5: 20% soul_shard
6:39.904 incinerate Fluffy_Pillow 272918.0/1100000: 25% mana | 1.0/5: 20% soul_shard
6:41.552 immolate Fluffy_Pillow 227634.1/1100000: 21% mana | 1.0/5: 20% soul_shard
6:42.868 dimensional_rift Fluffy_Pillow 178176.9/1100000: 16% mana | 1.0/5: 20% soul_shard
6:44.186 incinerate Fluffy_Pillow 194744.7/1100000: 18% mana | 1.0/5: 20% soul_shard
6:45.837 dimensional_rift Fluffy_Pillow 149498.6/1100000: 14% mana | 1.0/5: 20% soul_shard
6:47.153 incinerate Fluffy_Pillow 166041.3/1100000: 15% mana | 1.0/5: 20% soul_shard
6:48.803 incinerate Fluffy_Pillow 120782.6/1100000: 11% mana | 1.0/5: 20% soul_shard
6:50.452 immolate Fluffy_Pillow 75511.2/1100000: 7% mana | 1.0/5: 20% soul_shard
6:51.768 conflagrate Fluffy_Pillow 26054.0/1100000: 2% mana | 1.0/5: 20% soul_shard
6:53.085 chaos_bolt Fluffy_Pillow 20609.3/1100000: 2% mana | 2.0/5: 40% soul_shard
6:55.277 incinerate Fluffy_Pillow 433163.7/1100000: 39% mana | 0.0/5: 0% soul_shard
6:56.926 incinerate Fluffy_Pillow 387892.4/1100000: 35% mana | 0.0/5: 0% soul_shard
6:58.575 incinerate Fluffy_Pillow 342621.1/1100000: 31% mana | 0.0/5: 0% soul_shard
7:00.225 incinerate Fluffy_Pillow 297362.4/1100000: 27% mana | 0.0/5: 0% soul_shard
7:01.873 conflagrate Fluffy_Pillow 252078.5/1100000: 23% mana | 0.0/5: 0% soul_shard
7:03.189 conflagrate Fluffy_Pillow 246621.2/1100000: 22% mana | 1.0/5: 20% soul_shard
7:04.507 chaos_bolt Fluffy_Pillow 241189.1/1100000: 22% mana | 2.0/5: 40% soul_shard
7:06.699 incinerate Fluffy_Pillow 653743.5/1100000: 59% mana | 1.0/5: 20% soul_shard
7:08.350 chaos_bolt Fluffy_Pillow 608497.4/1100000: 55% mana | 2.0/5: 40% soul_shard
7:10.540 incinerate Fluffy_Pillow 1021026.7/1100000: 93% mana | 1.0/5: 20% soul_shard
7:12.189 incinerate Fluffy_Pillow 975755.4/1100000: 89% mana | 1.0/5: 20% soul_shard
7:13.838 immolate Fluffy_Pillow 930484.1/1100000: 85% mana | 1.0/5: 20% soul_shard
7:15.154 conflagrate Fluffy_Pillow 881026.8/1100000: 80% mana | 1.0/5: 20% soul_shard
7:16.471 chaos_bolt Fluffy_Pillow 875582.1/1100000: 80% mana | 2.0/5: 40% soul_shard
7:18.662 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard
7:20.312 incinerate Fluffy_Pillow 1034062.9/1100000: 94% mana | 0.0/5: 0% soul_shard
7:21.959 incinerate Fluffy_Pillow 988766.4/1100000: 90% mana | 0.0/5: 0% soul_shard
7:23.608 conflagrate Fluffy_Pillow 943495.1/1100000: 86% mana | 0.0/5: 0% soul_shard
7:24.924 incinerate Fluffy_Pillow 938037.8/1100000: 85% mana | 1.0/5: 20% soul_shard
7:26.571 incinerate Fluffy_Pillow 892741.4/1100000: 81% mana | 1.0/5: 20% soul_shard
7:28.218 incinerate Fluffy_Pillow 847444.9/1100000: 77% mana | 1.0/5: 20% soul_shard
7:29.866 dimensional_rift Fluffy_Pillow 802161.0/1100000: 73% mana | 1.0/5: 20% soul_shard
7:31.316 immolate Fluffy_Pillow 820388.2/1100000: 75% mana | 1.0/5: 20% soul_shard
7:32.634 incinerate Fluffy_Pillow 770956.1/1100000: 70% mana | 1.0/5: 20% soul_shard

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 29902 29902 18608
Intellect 29993 28287 19613 (665)
Spirit 0 0 0
Health 1794120 1794120 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 29993 28287 0
Crit 11.87% 11.87% 2405
Haste 14.28% 13.10% 4257
Damage / Heal Versatility 3.18% 3.18% 1273
ManaReg per Second 12570 12441 0
Mastery 112.83% 112.83% 10362
Armor 1604 1604 1604
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 845.00
Local Head Celestially Aligned Hood
ilevel: 850, stats: { 211 Armor, +1945 Sta, +1297 Int, +932 Mastery, +372 Haste }
Local Neck Wolfstride Pendant
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Haste }, gems: { +150 Crit }
Local Shoulders Vindictive Gladiator's Felweave Amice of the Aurora
ilevel: 850, stats: { 195 Armor, +973 Int, +1459 Sta, +630 Haste, +350 Vers }
Local Shirt Last Season's Shirt
ilevel: 1
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Poisonroot Belt
ilevel: 840, stats: { 141 Armor, +886 Int, +1329 Sta, +552 Mastery, +391 Crit }
Local Legs Riverrider Legwraps
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +833 Mastery, +448 Haste }
Local Feet Cushioned Treads of Glory
ilevel: 845, stats: { 176 Armor, +1393 Sta, +929 Int, +584 Mastery, +378 Haste }
Local Wrists Ragged Fur Wristwraps
ilevel: 850, stats: { 114 Armor, +1094 Sta, +729 Int, +414 Mastery, +320 Haste }
Local Hands Latosius's Blasting Gloves
ilevel: 840, stats: { 157 Armor, +886 Int, +1329 Sta, +653 Mastery, +289 Crit }
Local Finger1 Ring of Twisted Webbing
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }
Local Finger2 Signet of the Highborne Magi
ilevel: 835, stats: { +952 Sta, +1092 Mastery, +645 Crit }, enchant: { +150 Haste }
Local Trinket1 Horn of Valor
ilevel: 840, stats: { +898 Vers }
Local Trinket2 Huge Roggstone
ilevel: 830, stats: { +1023 Int, +865 Mastery }
Local Back Cloak of Unwavering Loyalty
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Crit, +252 Mastery }, enchant: { +150 Int }
Local Main Hand Scepter of Sargeras
ilevel: 864, weapon: { 3822 - 5735, 3.6 }, stats: { +1478 Int, +2217 Sta, +689 Haste, +689 Mastery, +8062 Int }, relics: { +42 ilevels, +36 ilevels, +36 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Cataclysm (Destruction Warlock) Mana Tap
45 Demon Skin Mortal Coil Shadowfury
60 Eradication (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demonic Circle Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Eldiabløød"
origin="https://eu.api.battle.net/wow/character/hyjal/Eldiabløød/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/7/115092743-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=enchanting=754/herbalism=8
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Vb!1001212
artifact=38:0:0:0:0:803:1:804:3:805:3:806:3:808:2:809:1:810:3:812:3:814:1:816:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=use_item,name=horn_of_valor
actions+=/havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/chaos_bolt,if=soul_shard>3|buff.backdraft.remains
actions+=/chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
actions+=/incinerate,if=buff.backdraft.remains
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
actions+=/chaos_bolt
actions+=/cataclysm
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/life_tap,if=talent.mana_tap.enabled&mana.pct<=10
actions+=/incinerate
actions+=/life_tap

head=celestially_aligned_hood,id=139188,bonus_id=1807/1808/1472
neck=wolfstride_pendant,id=133633,bonus_id=1727/1808/1492/1813,gems=150crit
shoulders=vindictive_gladiators_felweave_amice,id=135668,bonus_id=3428/1705/1482/3336
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1727/1492/1813,enchant=150int
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
shirt=last_seasons_shirt,id=98091
wrists=ragged_fur_wristwraps,id=139196,bonus_id=1807/1472
hands=latosiuss_blasting_gloves,id=134431,bonus_id=1727/1492/1813
waist=poisonroot_belt,id=134423,bonus_id=1727/1492/1813
legs=riverrider_legwraps,id=134427,bonus_id=1727/1497/3336
feet=cushioned_treads_of_glory,id=136774,bonus_id=1727/1497/3336
finger1=ring_of_twisted_webbing,id=134540,bonus_id=1727/1502/3336
finger2=signet_of_the_highborne_magi,id=134537,bonus_id=1726/1487/3339,enchant=150haste
trinket1=horn_of_valor,id=133642,bonus_id=1727/1492/1813
trinket2=huge_roggstone,id=134160,bonus_id=3397/605/1492/1675
main_hand=scepter_of_sargeras,id=128941,bonus_id=749,gem_id=137476/137316/142058/0,relic_id=1727:1497:3336/1826:1477:3338/0/0

# Gear Summary
# gear_ilvl=844.60
# gear_stamina=18608
# gear_intellect=19613
# gear_crit_rating=2358
# gear_haste_rating=4174
# gear_mastery_rating=10159
# gear_versatility_rating=1248
# gear_armor=1604
default_pet=imp

Zuan

Zuan : 305849 dps

  • Race: Human
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
305849.3 305849.3 314.1 / 0.103% 63156.4 / 20.6% 35039.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.7 8.7 Rage 23.63% 74.8 100.0% 100%
Origin https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Defensive Stance (Arms Warrior)
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact
Professions
  • mining: 775
  • blacksmithing: 761

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zuan 305849
auto_attack_mh 21107 6.9% 143.2 3.17sec 66335 21057 Direct 143.2 53524 109467 66334 22.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.22 143.22 0.00 0.00 3.1502 0.0000 9500671.86 13966887.57 31.98 21057.15 21057.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 110.43 77.10% 53524.45 28853 69565 53544.25 46972 59834 5910643 8689206 31.98
crit 32.80 22.90% 109466.72 57705 139129 109523.69 91216 126481 3590028 5277682 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (4285) 0.0% (1.4%) 5.0 96.72sec 383730 193747

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.03 0.00 15.10 0.00 1.9806 0.5756 0.00 0.00 0.00 193746.63 193746.63
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 4285 1.4% 0.0 0.00sec 0 0 Direct 15.1 117872 236234 127701 8.3%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 15.10 0.00 0.00 0.0000 0.0000 1928360.20 2834872.15 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.85 91.70% 117872.46 59005 142263 118125.84 68256 142263 1632222 2399520 31.98
crit 1.25 8.30% 236234.22 118009 284525 172758.93 0 284525 296139 435352 23.33
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.17
 
Colossus Smash 38275 12.5% 61.7 7.43sec 279057 210348 Direct 61.7 233980 441870 279056 21.7%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.69 61.69 0.00 0.00 1.3266 0.0000 17216166.63 25309395.71 31.98 210348.30 210348.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.32 78.32% 233979.59 127358 307066 233529.57 192047 261431 11305108 16619580 31.98
crit 13.38 21.68% 441870.38 254717 614132 441122.00 275094 573190 5911059 8689816 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 29863 9.8% 0.0 0.00sec 0 0 Periodic 83.5 160907 0 160907 0.0% 37.1%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 83.47 83.47 0.0000 2.0000 13431357.36 13431357.36 0.00 80453.30 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.5 100.00% 160907.48 14373 345526 161134.83 103311 210184 13431357 13431357 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 44819 14.7% 40.3 2.26sec 500359 367506 Direct 40.3 353486 792530 500381 33.5%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.30 40.30 0.00 0.00 1.3615 0.0000 20163225.30 29641851.10 31.98 367506.16 367506.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.82 66.55% 353486.04 43948 550998 353981.67 225601 445309 9479044 13935092 31.98
crit 13.48 33.45% 792529.51 94489 1101996 789928.09 392094 966013 10684182 15706759 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m3 additional Rage to deal up to ${$sw2*3} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Hamstring 802 0.3% 70.4 6.31sec 5121 0 Direct 70.4 0 5121 5121 100.0%  

Stats details: hamstring

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.43 70.43 0.00 0.00 0.0000 0.0000 360711.47 530280.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 70.43 100.00% 5121.35 2713 6541 5123.75 4062 5814 360711 530280 31.98
 
 

Action details: hamstring

Static Values
  • id:1715
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
Spelldata
  • id:1715
  • name:Hamstring
  • school:physical
  • tooltip:Movement slowed by {$s1=50}%.
  • description:Maims the enemy for $sw3 Physical damage, reducing movement speed by {$s1=50}% for {$d=15 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.05
 
Mark of the Hidden Satyr 5758 1.9% 24.2 18.48sec 107147 0 Direct 24.2 87245 175774 107144 22.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.19 24.19 0.00 0.00 0.0000 0.0000 2591719.97 2591719.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.75 77.52% 87245.11 47243 113905 87240.22 59298 105468 1635993 1635993 0.00
crit 5.44 22.48% 175774.34 94487 227811 175184.27 0 227811 955727 955727 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:41625.00
  • base_dd_max:48375.00
 
Mortal Strike 116399 38.1% 83.9 5.25sec 624633 474207 Direct 83.9 385402 916656 624623 45.0%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.86 83.86 0.00 0.00 1.3172 0.0000 52384256.18 77009818.56 31.98 474207.29 474207.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.10 54.97% 385402.07 132622 607539 385373.19 299772 466881 17767705 26120210 31.98
crit 37.76 45.03% 916655.57 265244 1215079 916894.96 753417 1047608 34616551 50889609 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals $sw3 Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 17868 5.8% 21.9 19.82sec 362346 0 Direct 21.9 275801 573023 362348 29.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 0.0000 0.0000 7926312.15 11652429.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.50 70.88% 275800.88 133465 321790 275340.92 184995 321790 4275996 6286119 31.98
crit 6.37 29.12% 573023.19 266930 643580 573049.72 329705 643580 3650316 5366311 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Slam 22535 7.4% 54.9 6.48sec 184771 140679 Direct 54.9 129553 252461 184765 44.9%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.92 54.92 0.00 0.00 1.3134 0.0000 10148299.40 14918961.39 31.98 140678.97 140678.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.25 55.08% 129553.14 70509 170001 129730.24 100413 154417 3919158 5761533 31.98
crit 24.67 44.92% 252461.24 141019 340001 253043.08 174387 311668 6229142 9157428 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 4138 1.4% 7.1 66.31sec 261559 198531 Direct 7.1 222288 456401 261548 16.8%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 1.3176 0.0000 1860238.34 1860238.34 0.00 198531.31 198531.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.92 83.23% 222288.02 126896 305951 222006.36 126896 293203 1315896 1315896 0.00
crit 1.19 16.77% 456401.33 253792 611903 332023.02 0 611903 544342 544342 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Zuan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Avatar 5.5 90.00sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 14.2 33.01sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Focused Rage 205.9 2.15sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.92 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zuan
  • harmful:false
  • if_expr:
 
Heroic Leap 10.0 47.24sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 5.5 0.0 90.0sec 90.0sec 23.91% 23.97% 0.0(0.0) 5.2

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:23.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 14.2 0.0 33.0sec 33.0sec 15.63% 15.68% 0.0(0.0) 14.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:15.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 5.0 0.0 96.8sec 96.8sec 1.93% 1.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.87% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 14.2 0.0 33.0sec 33.0sec 15.63% 26.68% 0.0(0.0) 14.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:15.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 84.9 121.1 5.2sec 2.1sec 82.25% 61.71% 3.0(3.0) 0.2

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:48.47%
  • focused_rage_2:20.69%
  • focused_rage_3:13.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 371.4sec 0.0sec 10.83% 10.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 68.8 0.0 6.6sec 6.6sec 26.21% 26.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.45

Stack Uptimes

  • precise_strikes_1:26.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shattered Defenses 68.8 0.0 6.6sec 6.6sec 26.21% 35.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:26.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry1.3620.0017.8517.0290.00023.977
Avatar0.1270.0011.6800.0030.0001.680
Hamstring27.6360.00138.671368.211271.502469.487
Heroic Leap3.0320.00125.27719.7310.44691.086
Focused Rage1.6620.00138.132170.009103.231239.188
Colossus Smash1.3630.0016.99380.24840.543136.600
Warbreaker7.6210.00195.81538.4580.000144.486
Mortal Strike1.5050.00134.27797.89039.310171.544
Bladestorm8.6970.001100.19727.5330.000133.174

Resources

Resource Usage Type Count Total Average RPE APR
Zuan
execute Rage 40.3 815.1 20.2 20.2 24735.7
focused_rage Rage 205.9 1856.3 9.0 9.0 0.0
mortal_strike Rage 83.9 724.6 8.6 8.6 72295.7
slam Rage 54.9 528.5 9.6 9.6 19201.9
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.51%) 20.00 0.00 0.00%
melee_crit Rage 32.79 1165.44 (29.48%) 35.54 44.79 3.70%
melee_main_hand Rage 110.43 2767.31 (70.01%) 25.06 15.46 0.56%
Resource RPS-Gain RPS-Loss
Rage 8.77 8.71
Combat End Resource Mean Min Max
Rage 27.11 0.00 124.10

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 1.3%

Procs

Count Interval
tactician 66.6 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data Zuan Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Zuan Damage Per Second
Count 9999
Mean 305849.25
Minimum 248842.31
Maximum 368947.94
Spread ( max - min ) 120105.63
Range [ ( max - min ) / 2 * 100% ] 19.63%
Standard Deviation 16027.2834
5th Percentile 280058.97
95th Percentile 332819.71
( 95th Percentile - 5th Percentile ) 52760.74
Mean Distribution
Standard Deviation 160.2808
95.00% Confidence Intervall ( 305535.11 - 306163.40 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10548
0.1 Scale Factor Error with Delta=300 2192822
0.05 Scale Factor Error with Delta=300 8771290
0.01 Scale Factor Error with Delta=300 219282261
Priority Target DPS
Sample Data Zuan Priority Target Damage Per Second
Count 9999
Mean 305849.25
Minimum 248842.31
Maximum 368947.94
Spread ( max - min ) 120105.63
Range [ ( max - min ) / 2 * 100% ] 19.63%
Standard Deviation 16027.2834
5th Percentile 280058.97
95th Percentile 332819.71
( 95th Percentile - 5th Percentile ) 52760.74
Mean Distribution
Standard Deviation 160.2808
95.00% Confidence Intervall ( 305535.11 - 306163.40 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10548
0.1 Scale Factor Error with Delta=300 2192822
0.05 Scale Factor Error with Delta=300 8771290
0.01 Scale Factor Error with Delta=300 219282261
DPS(e)
Sample Data Zuan Damage Per Second (Effective)
Count 9999
Mean 305849.25
Minimum 248842.31
Maximum 368947.94
Spread ( max - min ) 120105.63
Range [ ( max - min ) / 2 * 100% ] 19.63%
Damage
Sample Data Zuan Damage
Count 9999
Mean 137511318.87
Minimum 92409389.43
Maximum 182453012.54
Spread ( max - min ) 90043623.11
Range [ ( max - min ) / 2 * 100% ] 32.74%
DTPS
Sample Data Zuan Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zuan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zuan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zuan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zuan Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zuan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZuanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zuan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
0.00 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
8 14.15 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
9 5.52 avatar,if=(buff.bloodlust.up|time>=1)
A 70.43 hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
B 10.03 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
C 51.23 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike. # In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
D 17.20 colossus_smash,if=debuff.colossus_smash.down
E 2.49 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
F 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=execute,if=target.health.pct<=20
I 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
J 3.56 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
K 6.52 execute,if=buff.battle_cry_deadly_calm.up
L 10.94 colossus_smash,if=buff.shattered_defenses.down
M 1.03 warbreaker,if=buff.shattered_defenses.down&rage<=30
N 33.78 execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
O 0.82 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
actions.single
# count action,conditions
P 5.38 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
Q 33.55 colossus_smash,if=buff.shattered_defenses.down
R 3.60 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
S 154.69 focused_rage,if=((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
T 74.92 mortal_strike
0.00 execute,if=buff.stone_heart.react
U 54.93 slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
0.00 execute,if=equipped.archavons_heavy_hand
0.00 slam,if=equipped.archavons_heavy_hand
0.00 focused_rage,if=equipped.archavons_heavy_hand
V 4.20 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.

Sample Sequence

012456DS9SB8ATACUACUACRACPSUSVSUTSUSSTSSTSTSTSDSSTS8AUCAUCAUCATCAUCUSUTDSSTQSSTBQSSTSSTSUSSTSTDSS8ATACUACUAACPQSSUSTQSSTQSSSUTSESSTS9BTSVSTDSS8ATACQACTAACUSUSUTSTDSSTQSSTQSSTQSSTQSSTQSSTQSS8ATACBQACTAACQSSTQSSUSUTSESSUTSTSTSUSSD8ATCAQCACTAACPQSSTQSST9SBUSSUTSVSSUTSTSTS8AUCACDATCAAPCQSSTSQSTSUSSQTQSSTSQSTQSSBSUTQSSSU8ATCAUCACUAADTSRSSTSTSDSSTQSSTSTSTS9USS8AUATCACUAACUUTSVSSUDBTQSSTQSSTQSSSUTSTSESS8AUACUACTAACUSUDSTSUSQSTSUSSUTDSSTQSSTBQSSTQSS8AUACUACTAACUSSDTSUSSTSUDSST9QSSTQSSTLNNNL87ACKACKACJAACKBLNNLNNLNLNLNNLNNMNLNNL8ACKACKACJAACKLNNNLNNBLNNONNDNN8ACKACDAJCAAKCNLNN9L

Sample Sequence Table

time name target resources buffs
Pre flask Zuan 0.0/130: 0% rage
Pre food Zuan 0.0/130: 0% rage
Pre augmentation Zuan 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 45.2/130: 35% rage potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 33.2/130: 26% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.000 avatar Fluffy_Pillow 33.2/130: 26% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.274 focused_rage Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.277 heroic_leap Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.277 battle_cry Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.277 hamstring Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.277 mortal_strike Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:02.277 hamstring Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
0:02.327 focused_rage Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
0:02.327 slam Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.277 hamstring Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.376 focused_rage Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.376 slam Fluffy_Pillow 46.4/130: 36% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:04.277 hamstring Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:04.420 focused_rage Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, potion_of_the_old_war
0:04.425 warbreaker Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, potion_of_the_old_war
0:05.277 hamstring Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:05.464 focused_rage Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:05.472 mortal_strike Fluffy_Pillow 82.8/130: 64% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:06.508 focused_rage Fluffy_Pillow 108.5/130: 83% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:06.520 slam Fluffy_Pillow 108.5/130: 83% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:07.552 focused_rage Fluffy_Pillow 80.5/130: 62% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:07.569 bladestorm Fluffy_Pillow 80.5/130: 62% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:09.230 focused_rage Fluffy_Pillow 105.7/130: 81% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:09.230 slam Fluffy_Pillow 93.7/130: 72% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:10.277 mortal_strike Fluffy_Pillow 77.7/130: 60% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:10.277 focused_rage Fluffy_Pillow 49.7/130: 38% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:11.326 Waiting 2.200 sec 74.9/130: 58% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:13.526 slam Fluffy_Pillow 100.1/130: 77% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:13.526 focused_rage Fluffy_Pillow 72.1/130: 55% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:14.570 focused_rage Fluffy_Pillow 60.1/130: 46% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:14.574 mortal_strike Fluffy_Pillow 60.1/130: 46% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:15.614 focused_rage Fluffy_Pillow 32.1/130: 25% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:15.621 Waiting 0.800 sec 32.1/130: 25% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:16.421 focused_rage Fluffy_Pillow 57.3/130: 44% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:16.658 Waiting 1.900 sec 45.3/130: 35% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:18.558 mortal_strike Fluffy_Pillow 70.5/130: 54% rage bloodlust, avatar, focused_rage(2), potion_of_the_old_war
0:18.750 focused_rage Fluffy_Pillow 42.5/130: 33% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:19.797 Waiting 2.900 sec 42.5/130: 33% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:22.697 mortal_strike Fluffy_Pillow 67.7/130: 52% rage bloodlust, focused_rage, potion_of_the_old_war
0:22.926 focused_rage Fluffy_Pillow 39.7/130: 31% rage bloodlust, focused_rage, potion_of_the_old_war
0:23.973 Waiting 2.900 sec 64.9/130: 50% rage bloodlust, focused_rage
0:26.873 mortal_strike Fluffy_Pillow 90.1/130: 69% rage bloodlust, focused_rage
0:27.102 focused_rage Fluffy_Pillow 62.1/130: 48% rage bloodlust, focused_rage
0:28.151 Waiting 1.600 sec 62.1/130: 48% rage bloodlust, focused_rage
0:29.751 colossus_smash Fluffy_Pillow 87.3/130: 67% rage bloodlust, focused_rage
0:30.000 focused_rage Fluffy_Pillow 75.3/130: 58% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:31.044 focused_rage Fluffy_Pillow 63.3/130: 49% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:31.049 mortal_strike Fluffy_Pillow 63.3/130: 49% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:32.088 focused_rage Fluffy_Pillow 67.7/130: 52% rage bloodlust, focused_rage
0:32.325 battle_cry Fluffy_Pillow 67.7/130: 52% rage bloodlust, focused_rage
0:32.325 hamstring Fluffy_Pillow 67.7/130: 52% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:32.325 slam Fluffy_Pillow 67.7/130: 52% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:33.132 focused_rage Fluffy_Pillow 67.7/130: 52% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:33.325 hamstring Fluffy_Pillow 67.7/130: 52% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:33.374 slam Fluffy_Pillow 67.7/130: 52% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:34.176 focused_rage Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:34.325 hamstring Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:34.423 slam Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:35.220 focused_rage Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:35.325 hamstring Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:35.472 mortal_strike Fluffy_Pillow 103.8/130: 80% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:36.264 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:36.364 hamstring Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:36.521 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:37.308 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:37.569 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, focused_rage(2)
0:38.352 focused_rage Fluffy_Pillow 102.0/130: 78% rage bloodlust, focused_rage(3)
0:38.618 slam Fluffy_Pillow 127.2/130: 98% rage bloodlust, focused_rage(3)
0:39.668 mortal_strike Fluffy_Pillow 111.2/130: 86% rage bloodlust, focused_rage(3)
0:40.716 colossus_smash Fluffy_Pillow 95.2/130: 73% rage bloodlust
0:40.716 focused_rage Fluffy_Pillow 83.2/130: 64% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:41.993 focused_rage Fluffy_Pillow 108.4/130: 83% rage focused_rage, precise_strikes, shattered_defenses
0:41.993 mortal_strike Fluffy_Pillow 96.4/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
0:43.356 colossus_smash Fluffy_Pillow 87.6/130: 67% rage
0:43.356 focused_rage Fluffy_Pillow 75.6/130: 58% rage focused_rage, precise_strikes, shattered_defenses
0:44.713 focused_rage Fluffy_Pillow 88.8/130: 68% rage focused_rage(2), precise_strikes, shattered_defenses
0:44.718 mortal_strike Fluffy_Pillow 88.8/130: 68% rage focused_rage(2), precise_strikes, shattered_defenses
0:46.079 heroic_leap Fluffy_Pillow 80.0/130: 62% rage
0:46.277 colossus_smash Fluffy_Pillow 80.0/130: 62% rage
0:46.277 focused_rage Fluffy_Pillow 68.0/130: 52% rage focused_rage, precise_strikes, shattered_defenses
0:47.634 focused_rage Fluffy_Pillow 81.2/130: 62% rage focused_rage(2), precise_strikes, shattered_defenses
0:47.639 mortal_strike Fluffy_Pillow 81.2/130: 62% rage focused_rage(2), precise_strikes, shattered_defenses
0:48.991 focused_rage Fluffy_Pillow 60.4/130: 46% rage focused_rage
0:49.001 Waiting 1.100 sec 60.4/130: 46% rage focused_rage
0:50.101 focused_rage Fluffy_Pillow 60.4/130: 46% rage focused_rage
0:50.348 Waiting 2.500 sec 48.4/130: 37% rage focused_rage(2)
0:52.848 mortal_strike Fluffy_Pillow 85.5/130: 66% rage focused_rage(2)
0:53.068 focused_rage Fluffy_Pillow 57.5/130: 44% rage focused_rage
0:54.431 Waiting 3.000 sec 82.7/130: 64% rage focused_rage
0:57.431 slam Fluffy_Pillow 107.9/130: 83% rage focused_rage
0:57.431 focused_rage Fluffy_Pillow 79.9/130: 61% rage focused_rage(2)
0:58.788 focused_rage Fluffy_Pillow 67.9/130: 52% rage focused_rage(3)
0:58.790 mortal_strike Fluffy_Pillow 67.9/130: 52% rage focused_rage(3)
1:00.145 focused_rage Fluffy_Pillow 39.9/130: 31% rage focused_rage
1:00.150 Waiting 3.900 sec 39.9/130: 31% rage focused_rage
1:04.050 mortal_strike Fluffy_Pillow 90.3/130: 69% rage focused_rage
1:05.581 colossus_smash Fluffy_Pillow 74.3/130: 57% rage
1:05.581 focused_rage Fluffy_Pillow 62.3/130: 48% rage focused_rage, precise_strikes, shattered_defenses
1:06.938 focused_rage Fluffy_Pillow 50.3/130: 39% rage focused_rage(2), precise_strikes, shattered_defenses
1:06.943 battle_cry Fluffy_Pillow 50.3/130: 39% rage focused_rage(2), precise_strikes, shattered_defenses
1:06.943 hamstring Fluffy_Pillow 50.3/130: 39% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:06.943 mortal_strike Fluffy_Pillow 50.3/130: 39% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:07.943 hamstring Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, battle_cry
1:08.295 focused_rage Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:08.304 slam Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:08.943 hamstring Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:09.652 focused_rage Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:09.666 slam Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:09.943 hamstring Fluffy_Pillow 86.4/130: 66% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:10.943 hamstring Fluffy_Pillow 123.4/130: 95% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:11.027 focused_rage Fluffy_Pillow 123.4/130: 95% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:11.027 mortal_strike Fluffy_Pillow 123.4/130: 95% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:12.388 colossus_smash Fluffy_Pillow 123.4/130: 95% rage
1:12.388 focused_rage Fluffy_Pillow 111.4/130: 86% rage focused_rage, precise_strikes, shattered_defenses
1:13.745 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:13.751 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:15.102 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
1:15.113 mortal_strike Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
1:16.475 colossus_smash Fluffy_Pillow 81.2/130: 62% rage
1:16.475 focused_rage Fluffy_Pillow 69.2/130: 53% rage focused_rage, precise_strikes, shattered_defenses
1:17.832 focused_rage Fluffy_Pillow 82.4/130: 63% rage focused_rage(2), precise_strikes, shattered_defenses
1:17.836 mortal_strike Fluffy_Pillow 82.4/130: 63% rage focused_rage(2), precise_strikes, shattered_defenses
1:19.198 colossus_smash Fluffy_Pillow 73.6/130: 57% rage
1:19.198 focused_rage Fluffy_Pillow 61.6/130: 47% rage focused_rage, precise_strikes, shattered_defenses
1:20.555 focused_rage Fluffy_Pillow 74.8/130: 58% rage focused_rage(2), precise_strikes, shattered_defenses
1:20.559 Waiting 1.200 sec 74.8/130: 58% rage focused_rage(2), precise_strikes, shattered_defenses
1:21.759 focused_rage Fluffy_Pillow 74.8/130: 58% rage focused_rage(2), precise_strikes, shattered_defenses
1:21.912 slam Fluffy_Pillow 62.8/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses
1:23.272 mortal_strike Fluffy_Pillow 46.8/130: 36% rage focused_rage(3), precise_strikes, shattered_defenses
1:23.272 focused_rage Fluffy_Pillow 26.0/130: 20% rage focused_rage
1:24.634 Waiting 2.600 sec 51.2/130: 39% rage focused_rage
1:27.234 warbreaker Fluffy_Pillow 76.4/130: 59% rage focused_rage
1:27.234 focused_rage Fluffy_Pillow 64.4/130: 50% rage focused_rage(2), precise_strikes, shattered_defenses
1:28.591 focused_rage Fluffy_Pillow 52.4/130: 40% rage focused_rage(3), precise_strikes, shattered_defenses
1:28.596 mortal_strike Fluffy_Pillow 52.4/130: 40% rage focused_rage(3), precise_strikes, shattered_defenses
1:29.948 focused_rage Fluffy_Pillow 31.6/130: 24% rage focused_rage
1:30.063 Waiting 0.700 sec 56.8/130: 44% rage focused_rage
1:30.763 avatar Fluffy_Pillow 56.8/130: 44% rage focused_rage
1:31.000 Waiting 0.100 sec 56.8/130: 44% rage avatar, focused_rage
1:31.100 heroic_leap Fluffy_Pillow 56.8/130: 44% rage avatar, focused_rage
1:31.277 Waiting 2.700 sec 56.8/130: 44% rage avatar, focused_rage
1:33.977 mortal_strike Fluffy_Pillow 82.0/130: 63% rage avatar, focused_rage
1:34.130 focused_rage Fluffy_Pillow 54.0/130: 42% rage avatar, focused_rage
1:35.492 Waiting 1.900 sec 54.0/130: 42% rage avatar, focused_rage
1:37.392 bladestorm Fluffy_Pillow 79.2/130: 61% rage avatar, focused_rage
1:39.667 focused_rage Fluffy_Pillow 79.2/130: 61% rage avatar, focused_rage
1:39.667 mortal_strike Fluffy_Pillow 67.2/130: 52% rage avatar, focused_rage(2)
1:41.028 colossus_smash Fluffy_Pillow 87.2/130: 67% rage avatar
1:41.028 focused_rage Fluffy_Pillow 75.2/130: 58% rage avatar, focused_rage, precise_strikes, shattered_defenses
1:42.385 focused_rage Fluffy_Pillow 63.2/130: 49% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:42.389 battle_cry Fluffy_Pillow 63.2/130: 49% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:42.389 hamstring Fluffy_Pillow 63.2/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:42.389 mortal_strike Fluffy_Pillow 63.2/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:43.389 hamstring Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, battle_cry
1:43.742 focused_rage Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:43.749 colossus_smash Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:44.389 hamstring Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
1:45.099 focused_rage Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:45.110 mortal_strike Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:45.389 hamstring Fluffy_Pillow 100.3/130: 77% rage avatar, corrupted_blood_of_zakajz, battle_cry
1:46.389 hamstring Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, battle_cry
1:46.471 focused_rage Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, battle_cry
1:46.471 slam Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:47.828 focused_rage Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage(2)
1:47.833 slam Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage(2)
1:49.185 focused_rage Fluffy_Pillow 90.0/130: 69% rage avatar, focused_rage(3)
1:49.195 slam Fluffy_Pillow 90.0/130: 69% rage avatar, focused_rage(3)
1:50.558 mortal_strike Fluffy_Pillow 99.2/130: 76% rage avatar, focused_rage(3)
1:50.558 focused_rage Fluffy_Pillow 71.2/130: 55% rage avatar, focused_rage
1:51.921 Waiting 3.900 sec 71.2/130: 55% rage focused_rage
1:55.821 mortal_strike Fluffy_Pillow 96.4/130: 74% rage focused_rage
1:57.349 colossus_smash Fluffy_Pillow 105.6/130: 81% rage
1:57.349 focused_rage Fluffy_Pillow 93.6/130: 72% rage focused_rage, precise_strikes, shattered_defenses
1:58.706 focused_rage Fluffy_Pillow 81.6/130: 63% rage focused_rage(2), precise_strikes, shattered_defenses
1:58.710 mortal_strike Fluffy_Pillow 81.6/130: 63% rage focused_rage(2), precise_strikes, shattered_defenses
2:00.073 colossus_smash Fluffy_Pillow 98.0/130: 75% rage
2:00.073 focused_rage Fluffy_Pillow 86.0/130: 66% rage focused_rage, precise_strikes, shattered_defenses
2:01.430 focused_rage Fluffy_Pillow 74.0/130: 57% rage focused_rage(2), precise_strikes, shattered_defenses
2:01.434 mortal_strike Fluffy_Pillow 74.0/130: 57% rage focused_rage(2), precise_strikes, shattered_defenses
2:02.795 colossus_smash Fluffy_Pillow 90.4/130: 70% rage
2:02.795 focused_rage Fluffy_Pillow 78.4/130: 60% rage focused_rage, precise_strikes, shattered_defenses
2:04.152 focused_rage Fluffy_Pillow 66.4/130: 51% rage focused_rage(2), precise_strikes, shattered_defenses
2:04.157 mortal_strike Fluffy_Pillow 66.4/130: 51% rage focused_rage(2), precise_strikes, shattered_defenses
2:05.518 colossus_smash Fluffy_Pillow 57.6/130: 44% rage
2:05.518 focused_rage Fluffy_Pillow 45.6/130: 35% rage focused_rage, precise_strikes, shattered_defenses
2:06.875 focused_rage Fluffy_Pillow 58.8/130: 45% rage focused_rage(2), precise_strikes, shattered_defenses
2:06.880 mortal_strike Fluffy_Pillow 58.8/130: 45% rage focused_rage(2), precise_strikes, shattered_defenses
2:08.241 colossus_smash Fluffy_Pillow 50.0/130: 38% rage
2:08.241 focused_rage Fluffy_Pillow 38.0/130: 29% rage focused_rage, precise_strikes, shattered_defenses
2:09.598 focused_rage Fluffy_Pillow 63.2/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses
2:09.602 mortal_strike Fluffy_Pillow 63.2/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses
2:10.962 colossus_smash Fluffy_Pillow 54.4/130: 42% rage
2:10.962 focused_rage Fluffy_Pillow 42.4/130: 33% rage focused_rage, precise_strikes, shattered_defenses
2:12.319 focused_rage Fluffy_Pillow 55.6/130: 43% rage focused_rage(2), precise_strikes, shattered_defenses
2:12.322 mortal_strike Fluffy_Pillow 55.6/130: 43% rage focused_rage(2), precise_strikes, shattered_defenses
2:13.683 colossus_smash Fluffy_Pillow 46.8/130: 36% rage
2:13.683 focused_rage Fluffy_Pillow 34.8/130: 27% rage focused_rage, precise_strikes, shattered_defenses
2:15.040 focused_rage Fluffy_Pillow 22.8/130: 18% rage focused_rage(2), precise_strikes, shattered_defenses
2:15.044 battle_cry Fluffy_Pillow 22.8/130: 18% rage focused_rage(2), precise_strikes, shattered_defenses
2:15.044 hamstring Fluffy_Pillow 22.8/130: 18% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:15.044 mortal_strike Fluffy_Pillow 22.8/130: 18% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:16.044 hamstring Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, battle_cry
2:16.397 focused_rage Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:16.406 heroic_leap Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:16.406 colossus_smash Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:17.044 hamstring Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
2:17.754 focused_rage Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:17.768 mortal_strike Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:18.044 hamstring Fluffy_Pillow 59.7/130: 46% rage corrupted_blood_of_zakajz, battle_cry
2:19.044 hamstring Fluffy_Pillow 96.0/130: 74% rage corrupted_blood_of_zakajz, battle_cry
2:19.130 focused_rage Fluffy_Pillow 96.0/130: 74% rage corrupted_blood_of_zakajz, battle_cry
2:19.130 colossus_smash Fluffy_Pillow 96.0/130: 74% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:20.487 focused_rage Fluffy_Pillow 84.0/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
2:20.494 Waiting 1.100 sec 84.0/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
2:21.594 focused_rage Fluffy_Pillow 84.0/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
2:21.844 mortal_strike Fluffy_Pillow 72.0/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
2:23.206 colossus_smash Fluffy_Pillow 88.4/130: 68% rage
2:23.206 focused_rage Fluffy_Pillow 76.4/130: 59% rage focused_rage, precise_strikes, shattered_defenses
2:24.563 focused_rage Fluffy_Pillow 64.4/130: 50% rage focused_rage(2), precise_strikes, shattered_defenses
2:24.568 Waiting 0.800 sec 64.4/130: 50% rage focused_rage(2), precise_strikes, shattered_defenses
2:25.368 slam Fluffy_Pillow 101.0/130: 78% rage focused_rage(2), precise_strikes, shattered_defenses
2:25.920 focused_rage Fluffy_Pillow 73.0/130: 56% rage focused_rage(3), precise_strikes, shattered_defenses
2:26.729 slam Fluffy_Pillow 73.0/130: 56% rage focused_rage(3), precise_strikes, shattered_defenses
2:28.090 mortal_strike Fluffy_Pillow 57.0/130: 44% rage focused_rage(3), precise_strikes, shattered_defenses
2:28.090 focused_rage Fluffy_Pillow 36.2/130: 28% rage focused_rage
2:29.453 Waiting 1.800 sec 61.4/130: 47% rage focused_rage
2:31.253 warbreaker Fluffy_Pillow 61.4/130: 47% rage focused_rage
2:31.253 focused_rage Fluffy_Pillow 49.4/130: 38% rage focused_rage(2), precise_strikes, shattered_defenses
2:32.610 focused_rage Fluffy_Pillow 62.6/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses
2:32.615 slam Fluffy_Pillow 62.6/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses
2:33.977 mortal_strike Fluffy_Pillow 46.6/130: 36% rage focused_rage(3), precise_strikes, shattered_defenses
2:33.977 focused_rage Fluffy_Pillow 25.8/130: 20% rage focused_rage
2:35.339 Waiting 3.900 sec 51.0/130: 39% rage focused_rage
2:39.239 mortal_strike Fluffy_Pillow 88.2/130: 68% rage focused_rage
2:39.406 focused_rage Fluffy_Pillow 60.2/130: 46% rage focused_rage
2:40.769 Waiting 3.900 sec 60.2/130: 46% rage focused_rage
2:44.669 mortal_strike Fluffy_Pillow 85.4/130: 66% rage focused_rage
2:44.835 focused_rage Fluffy_Pillow 57.4/130: 44% rage focused_rage
2:46.196 Waiting 2.000 sec 82.6/130: 64% rage focused_rage
2:48.196 slam Fluffy_Pillow 107.8/130: 83% rage focused_rage
2:48.196 focused_rage Fluffy_Pillow 79.8/130: 61% rage focused_rage(2)
2:49.553 focused_rage Fluffy_Pillow 67.8/130: 52% rage focused_rage(3)
2:49.556 colossus_smash Fluffy_Pillow 67.8/130: 52% rage focused_rage(3)
2:50.919 battle_cry Fluffy_Pillow 67.8/130: 52% rage focused_rage(3), precise_strikes, shattered_defenses
2:50.919 hamstring Fluffy_Pillow 67.8/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:50.919 mortal_strike Fluffy_Pillow 67.8/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:50.919 focused_rage Fluffy_Pillow 67.8/130: 52% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:51.919 hamstring Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:52.281 colossus_smash Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:52.281 focused_rage Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:52.919 hamstring Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:53.638 focused_rage Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:53.642 mortal_strike Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:53.919 hamstring Fluffy_Pillow 105.0/130: 81% rage corrupted_blood_of_zakajz, battle_cry
2:54.919 hamstring Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, battle_cry
2:55.003 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, battle_cry
2:55.003 mortal_strike Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:56.365 colossus_smash Fluffy_Pillow 130.0/130: 100% rage
2:56.365 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage, precise_strikes, shattered_defenses
2:57.722 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:57.726 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:59.088 colossus_smash Fluffy_Pillow 122.4/130: 94% rage
2:59.088 focused_rage Fluffy_Pillow 110.4/130: 85% rage focused_rage, precise_strikes, shattered_defenses
3:00.445 focused_rage Fluffy_Pillow 98.4/130: 76% rage focused_rage(2), precise_strikes, shattered_defenses
3:00.449 mortal_strike Fluffy_Pillow 98.4/130: 76% rage focused_rage(2), precise_strikes, shattered_defenses
3:01.000 avatar Fluffy_Pillow 89.6/130: 69% rage avatar
3:01.802 focused_rage Fluffy_Pillow 102.8/130: 79% rage avatar, focused_rage
3:01.812 heroic_leap Fluffy_Pillow 102.8/130: 79% rage avatar, focused_rage
3:01.812 slam Fluffy_Pillow 102.8/130: 79% rage avatar, focused_rage
3:03.159 focused_rage Fluffy_Pillow 74.8/130: 58% rage avatar, focused_rage(2)
3:03.174 Waiting 1.100 sec 74.8/130: 58% rage avatar, focused_rage(2)
3:04.274 focused_rage Fluffy_Pillow 74.8/130: 58% rage avatar, focused_rage(2)
3:04.516 slam Fluffy_Pillow 88.0/130: 68% rage avatar, focused_rage(3)
3:05.876 mortal_strike Fluffy_Pillow 72.0/130: 55% rage avatar, focused_rage(3)
3:05.878 focused_rage Fluffy_Pillow 44.0/130: 34% rage avatar, focused_rage
3:07.240 Waiting 0.100 sec 44.0/130: 34% rage avatar, focused_rage
3:07.340 bladestorm Fluffy_Pillow 44.0/130: 34% rage avatar, focused_rage
3:09.669 focused_rage Fluffy_Pillow 69.2/130: 53% rage avatar, focused_rage
3:09.669 Waiting 1.200 sec 57.2/130: 44% rage avatar, focused_rage(2)
3:10.869 focused_rage Fluffy_Pillow 57.2/130: 44% rage avatar, focused_rage(2)
3:11.026 slam Fluffy_Pillow 70.4/130: 54% rage avatar, focused_rage(3)
3:12.388 mortal_strike Fluffy_Pillow 54.4/130: 42% rage avatar, focused_rage(3)
3:12.388 focused_rage Fluffy_Pillow 26.4/130: 20% rage avatar, focused_rage
3:13.749 Waiting 3.900 sec 26.4/130: 20% rage avatar, focused_rage
3:17.649 mortal_strike Fluffy_Pillow 76.8/130: 59% rage avatar, focused_rage
3:17.817 focused_rage Fluffy_Pillow 48.8/130: 38% rage avatar, focused_rage
3:19.179 Waiting 3.900 sec 48.8/130: 38% rage avatar, focused_rage
3:23.079 mortal_strike Fluffy_Pillow 74.0/130: 57% rage focused_rage
3:23.246 focused_rage Fluffy_Pillow 46.0/130: 35% rage focused_rage
3:24.608 battle_cry Fluffy_Pillow 71.2/130: 55% rage focused_rage
3:24.608 hamstring Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:24.608 slam Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:24.608 focused_rage Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:25.608 hamstring Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:25.965 focused_rage Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:25.969 colossus_smash Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:26.608 hamstring Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:27.331 mortal_strike Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:27.331 focused_rage Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:27.608 hamstring Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:28.608 hamstring Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:28.692 mortal_strike Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:28.692 focused_rage Fluffy_Pillow 108.7/130: 84% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:30.053 colossus_smash Fluffy_Pillow 108.7/130: 84% rage focused_rage
3:30.053 focused_rage Fluffy_Pillow 96.7/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
3:31.410 focused_rage Fluffy_Pillow 109.9/130: 85% rage focused_rage(3), precise_strikes, shattered_defenses
3:31.415 mortal_strike Fluffy_Pillow 109.9/130: 85% rage focused_rage(3), precise_strikes, shattered_defenses
3:32.767 focused_rage Fluffy_Pillow 89.1/130: 69% rage focused_rage
3:32.776 colossus_smash Fluffy_Pillow 89.1/130: 69% rage focused_rage
3:34.124 focused_rage Fluffy_Pillow 102.3/130: 79% rage focused_rage(2), precise_strikes, shattered_defenses
3:34.137 mortal_strike Fluffy_Pillow 102.3/130: 79% rage focused_rage(2), precise_strikes, shattered_defenses
3:35.481 focused_rage Fluffy_Pillow 81.5/130: 63% rage focused_rage
3:35.499 Waiting 1.500 sec 81.5/130: 63% rage focused_rage
3:36.999 slam Fluffy_Pillow 106.7/130: 82% rage focused_rage
3:36.999 focused_rage Fluffy_Pillow 78.7/130: 61% rage focused_rage(2)
3:38.356 focused_rage Fluffy_Pillow 66.7/130: 51% rage focused_rage(3)
3:38.361 colossus_smash Fluffy_Pillow 66.7/130: 51% rage focused_rage(3)
3:39.723 mortal_strike Fluffy_Pillow 66.7/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses
3:41.085 colossus_smash Fluffy_Pillow 83.1/130: 64% rage
3:41.085 focused_rage Fluffy_Pillow 71.1/130: 55% rage focused_rage, precise_strikes, shattered_defenses
3:42.442 focused_rage Fluffy_Pillow 59.1/130: 45% rage focused_rage(2), precise_strikes, shattered_defenses
3:42.446 mortal_strike Fluffy_Pillow 59.1/130: 45% rage focused_rage(2), precise_strikes, shattered_defenses
3:43.799 focused_rage Fluffy_Pillow 63.5/130: 49% rage focused_rage
3:43.808 colossus_smash Fluffy_Pillow 63.5/130: 49% rage focused_rage
3:45.156 focused_rage Fluffy_Pillow 51.5/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
3:45.170 mortal_strike Fluffy_Pillow 51.5/130: 40% rage focused_rage(2), precise_strikes, shattered_defenses
3:46.532 colossus_smash Fluffy_Pillow 42.7/130: 33% rage
3:46.532 focused_rage Fluffy_Pillow 30.7/130: 24% rage focused_rage, precise_strikes, shattered_defenses
3:47.889 focused_rage Fluffy_Pillow 43.9/130: 34% rage focused_rage(2), precise_strikes, shattered_defenses
3:47.894 heroic_leap Fluffy_Pillow 43.9/130: 34% rage focused_rage(2), precise_strikes, shattered_defenses
3:47.894 Waiting 1.200 sec 43.9/130: 34% rage focused_rage(2), precise_strikes, shattered_defenses
3:49.094 focused_rage Fluffy_Pillow 43.9/130: 34% rage focused_rage(2), precise_strikes, shattered_defenses
3:49.246 slam Fluffy_Pillow 31.9/130: 25% rage focused_rage(3), precise_strikes, shattered_defenses
3:50.606 mortal_strike Fluffy_Pillow 41.1/130: 32% rage focused_rage(3), precise_strikes, shattered_defenses
3:51.967 colossus_smash Fluffy_Pillow 32.3/130: 25% rage
3:51.967 focused_rage Fluffy_Pillow 20.3/130: 16% rage focused_rage, precise_strikes, shattered_defenses
3:53.324 focused_rage Fluffy_Pillow 33.5/130: 26% rage focused_rage(2), precise_strikes, shattered_defenses
3:53.331 Waiting 1.100 sec 33.5/130: 26% rage focused_rage(2), precise_strikes, shattered_defenses
3:54.431 focused_rage Fluffy_Pillow 33.5/130: 26% rage focused_rage(2), precise_strikes, shattered_defenses
3:54.681 slam Fluffy_Pillow 21.5/130: 17% rage focused_rage(3), precise_strikes, shattered_defenses
3:56.042 battle_cry Fluffy_Pillow 5.5/130: 4% rage focused_rage(3), precise_strikes, shattered_defenses
3:56.042 hamstring Fluffy_Pillow 5.5/130: 4% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:56.042 mortal_strike Fluffy_Pillow 5.5/130: 4% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:56.042 focused_rage Fluffy_Pillow 5.5/130: 4% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:57.042 hamstring Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:57.403 slam Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:57.403 focused_rage Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:58.042 hamstring Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:58.760 focused_rage Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:58.766 slam Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:59.042 hamstring Fluffy_Pillow 41.7/130: 32% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:00.042 hamstring Fluffy_Pillow 79.5/130: 61% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:00.128 colossus_smash Fluffy_Pillow 79.5/130: 61% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:01.490 mortal_strike Fluffy_Pillow 79.5/130: 61% rage focused_rage(3), precise_strikes, shattered_defenses
4:01.490 focused_rage Fluffy_Pillow 58.7/130: 45% rage focused_rage
4:02.851 Waiting 2.800 sec 58.7/130: 45% rage focused_rage
4:05.651 warbreaker Fluffy_Pillow 83.9/130: 65% rage focused_rage
4:05.651 focused_rage Fluffy_Pillow 71.9/130: 55% rage focused_rage(2), precise_strikes, shattered_defenses
4:07.008 focused_rage Fluffy_Pillow 85.1/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
4:07.012 mortal_strike Fluffy_Pillow 85.1/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
4:08.365 focused_rage Fluffy_Pillow 64.3/130: 49% rage focused_rage
4:08.375 Waiting 3.900 sec 64.3/130: 49% rage focused_rage
4:12.275 mortal_strike Fluffy_Pillow 89.5/130: 69% rage focused_rage
4:12.441 focused_rage Fluffy_Pillow 61.5/130: 47% rage focused_rage
4:13.803 colossus_smash Fluffy_Pillow 86.7/130: 67% rage focused_rage
4:13.803 focused_rage Fluffy_Pillow 74.7/130: 57% rage focused_rage(2), precise_strikes, shattered_defenses
4:15.160 focused_rage Fluffy_Pillow 62.7/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses
4:15.165 mortal_strike Fluffy_Pillow 62.7/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses
4:16.526 colossus_smash Fluffy_Pillow 79.1/130: 61% rage
4:16.526 focused_rage Fluffy_Pillow 67.1/130: 52% rage focused_rage, precise_strikes, shattered_defenses
4:17.883 focused_rage Fluffy_Pillow 55.1/130: 42% rage focused_rage(2), precise_strikes, shattered_defenses
4:17.887 mortal_strike Fluffy_Pillow 55.1/130: 42% rage focused_rage(2), precise_strikes, shattered_defenses
4:19.240 focused_rage Fluffy_Pillow 34.3/130: 26% rage focused_rage
4:19.250 Waiting 3.900 sec 34.3/130: 26% rage focused_rage
4:23.150 mortal_strike Fluffy_Pillow 84.7/130: 65% rage focused_rage
4:23.316 focused_rage Fluffy_Pillow 56.7/130: 44% rage focused_rage
4:24.676 Waiting 3.900 sec 56.7/130: 44% rage focused_rage
4:28.576 mortal_strike Fluffy_Pillow 81.9/130: 63% rage focused_rage
4:28.745 focused_rage Fluffy_Pillow 53.9/130: 41% rage focused_rage
4:30.106 Waiting 0.700 sec 79.1/130: 61% rage focused_rage
4:30.806 avatar Fluffy_Pillow 79.1/130: 61% rage focused_rage
4:31.000 Waiting 1.400 sec 79.1/130: 61% rage avatar, focused_rage
4:32.400 slam Fluffy_Pillow 104.3/130: 80% rage avatar, focused_rage
4:32.400 focused_rage Fluffy_Pillow 76.3/130: 59% rage avatar, focused_rage(2)
4:33.757 focused_rage Fluffy_Pillow 64.3/130: 49% rage avatar, focused_rage(3)
4:33.761 battle_cry Fluffy_Pillow 64.3/130: 49% rage avatar, focused_rage(3)
4:33.761 hamstring Fluffy_Pillow 64.3/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:33.761 slam Fluffy_Pillow 64.3/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:34.761 hamstring Fluffy_Pillow 64.3/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:35.122 mortal_strike Fluffy_Pillow 64.3/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:35.122 focused_rage Fluffy_Pillow 64.3/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:35.761 hamstring Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:36.479 focused_rage Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:36.483 slam Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:36.761 hamstring Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:37.761 hamstring Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:37.845 focused_rage Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:37.845 slam Fluffy_Pillow 101.2/130: 78% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:39.207 slam Fluffy_Pillow 126.4/130: 97% rage avatar, focused_rage(3)
4:40.570 mortal_strike Fluffy_Pillow 110.4/130: 85% rage avatar, focused_rage(3)
4:40.570 focused_rage Fluffy_Pillow 82.4/130: 63% rage avatar, focused_rage
4:41.932 bladestorm Fluffy_Pillow 82.4/130: 63% rage avatar, focused_rage
4:44.088 focused_rage Fluffy_Pillow 107.6/130: 83% rage avatar, focused_rage
4:44.088 Waiting 1.200 sec 95.6/130: 74% rage avatar, focused_rage(2)
4:45.288 focused_rage Fluffy_Pillow 95.6/130: 74% rage avatar, focused_rage(2)
4:45.445 slam Fluffy_Pillow 108.8/130: 84% rage avatar, focused_rage(3)
4:46.805 colossus_smash Fluffy_Pillow 92.8/130: 71% rage avatar, focused_rage(3)
4:48.165 heroic_leap Fluffy_Pillow 92.8/130: 71% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
4:48.165 mortal_strike Fluffy_Pillow 92.8/130: 71% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
4:49.527 colossus_smash Fluffy_Pillow 109.2/130: 84% rage avatar
4:49.527 focused_rage Fluffy_Pillow 97.2/130: 75% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:50.884 focused_rage Fluffy_Pillow 85.2/130: 66% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:50.888 mortal_strike Fluffy_Pillow 85.2/130: 66% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:52.249 colossus_smash Fluffy_Pillow 101.6/130: 78% rage
4:52.249 focused_rage Fluffy_Pillow 89.6/130: 69% rage focused_rage, precise_strikes, shattered_defenses
4:53.606 focused_rage Fluffy_Pillow 77.6/130: 60% rage focused_rage(2), precise_strikes, shattered_defenses
4:53.610 mortal_strike Fluffy_Pillow 77.6/130: 60% rage focused_rage(2), precise_strikes, shattered_defenses
4:54.971 colossus_smash Fluffy_Pillow 68.8/130: 53% rage
4:54.971 focused_rage Fluffy_Pillow 56.8/130: 44% rage focused_rage, precise_strikes, shattered_defenses
4:56.328 focused_rage Fluffy_Pillow 70.0/130: 54% rage focused_rage(2), precise_strikes, shattered_defenses
4:56.331 Waiting 1.200 sec 70.0/130: 54% rage focused_rage(2), precise_strikes, shattered_defenses
4:57.531 focused_rage Fluffy_Pillow 70.0/130: 54% rage focused_rage(2), precise_strikes, shattered_defenses
4:57.685 slam Fluffy_Pillow 58.0/130: 45% rage focused_rage(3), precise_strikes, shattered_defenses
4:59.047 mortal_strike Fluffy_Pillow 79.7/130: 61% rage focused_rage(3), precise_strikes, shattered_defenses
4:59.047 focused_rage Fluffy_Pillow 58.9/130: 45% rage focused_rage
5:00.409 Waiting 3.900 sec 58.9/130: 45% rage focused_rage
5:04.309 mortal_strike Fluffy_Pillow 96.1/130: 74% rage focused_rage
5:04.476 focused_rage Fluffy_Pillow 68.1/130: 52% rage focused_rage
5:05.838 warbreaker Fluffy_Pillow 93.3/130: 72% rage focused_rage
5:05.838 focused_rage Fluffy_Pillow 81.3/130: 63% rage focused_rage(2), precise_strikes, shattered_defenses
5:07.195 focused_rage Fluffy_Pillow 69.3/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses
5:07.199 battle_cry Fluffy_Pillow 69.3/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses
5:07.199 hamstring Fluffy_Pillow 69.3/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:07.199 slam Fluffy_Pillow 69.3/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:08.199 hamstring Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:08.552 focused_rage Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:08.559 slam Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:09.199 hamstring Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:09.909 focused_rage Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:09.920 mortal_strike Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:10.199 hamstring Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, battle_cry
5:11.199 hamstring Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, battle_cry
5:11.280 focused_rage Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, battle_cry
5:11.280 slam Fluffy_Pillow 106.4/130: 82% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
5:12.637 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2)
5:12.641 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage(2)
5:14.002 colossus_smash Fluffy_Pillow 102.0/130: 78% rage focused_rage(2)
5:14.002 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
5:15.362 mortal_strike Fluffy_Pillow 115.2/130: 89% rage focused_rage(3), precise_strikes, shattered_defenses
5:15.362 focused_rage Fluffy_Pillow 94.4/130: 73% rage focused_rage
5:16.724 Waiting 1.300 sec 94.4/130: 73% rage focused_rage
5:18.024 slam Fluffy_Pillow 119.6/130: 92% rage focused_rage
5:18.024 focused_rage Fluffy_Pillow 91.6/130: 70% rage focused_rage(2)
5:19.385 colossus_smash Fluffy_Pillow 91.6/130: 70% rage focused_rage(2)
5:19.385 focused_rage Fluffy_Pillow 79.6/130: 61% rage focused_rage(3), precise_strikes, shattered_defenses
5:20.747 mortal_strike Fluffy_Pillow 79.6/130: 61% rage focused_rage(3), precise_strikes, shattered_defenses
5:20.747 focused_rage Fluffy_Pillow 58.8/130: 45% rage focused_rage
5:22.110 Waiting 2.400 sec 84.0/130: 65% rage focused_rage
5:24.510 slam Fluffy_Pillow 109.2/130: 84% rage focused_rage
5:24.510 focused_rage Fluffy_Pillow 81.2/130: 62% rage focused_rage(2)
5:25.867 focused_rage Fluffy_Pillow 69.2/130: 53% rage focused_rage(3)
5:25.872 slam Fluffy_Pillow 69.2/130: 53% rage focused_rage(3)
5:27.234 mortal_strike Fluffy_Pillow 53.2/130: 41% rage focused_rage(3)
5:28.595 colossus_smash Fluffy_Pillow 62.4/130: 48% rage
5:28.595 focused_rage Fluffy_Pillow 50.4/130: 39% rage focused_rage, precise_strikes, shattered_defenses
5:29.952 focused_rage Fluffy_Pillow 38.4/130: 30% rage focused_rage(2), precise_strikes, shattered_defenses
5:29.958 mortal_strike Fluffy_Pillow 38.4/130: 30% rage focused_rage(2), precise_strikes, shattered_defenses
5:31.319 colossus_smash Fluffy_Pillow 54.8/130: 42% rage
5:31.319 focused_rage Fluffy_Pillow 42.8/130: 33% rage focused_rage, precise_strikes, shattered_defenses
5:32.676 focused_rage Fluffy_Pillow 30.8/130: 24% rage focused_rage(2), precise_strikes, shattered_defenses
5:32.682 mortal_strike Fluffy_Pillow 30.8/130: 24% rage focused_rage(2), precise_strikes, shattered_defenses
5:34.044 heroic_leap Fluffy_Pillow 22.0/130: 17% rage
5:34.044 colossus_smash Fluffy_Pillow 22.0/130: 17% rage
5:34.044 focused_rage Fluffy_Pillow 10.0/130: 8% rage focused_rage, precise_strikes, shattered_defenses
5:35.401 focused_rage Fluffy_Pillow 34.9/130: 27% rage focused_rage(2), precise_strikes, shattered_defenses
5:35.405 mortal_strike Fluffy_Pillow 34.9/130: 27% rage focused_rage(2), precise_strikes, shattered_defenses
5:36.767 colossus_smash Fluffy_Pillow 26.1/130: 20% rage
5:36.767 focused_rage Fluffy_Pillow 14.1/130: 11% rage focused_rage, precise_strikes, shattered_defenses
5:38.124 focused_rage Fluffy_Pillow 39.8/130: 31% rage focused_rage(2), precise_strikes, shattered_defenses
5:38.130 battle_cry Fluffy_Pillow 39.8/130: 31% rage focused_rage(2), precise_strikes, shattered_defenses
5:38.130 hamstring Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
5:38.130 slam Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
5:39.130 hamstring Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
5:39.481 focused_rage Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:39.492 slam Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:40.130 hamstring Fluffy_Pillow 39.8/130: 31% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:40.838 focused_rage Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:40.855 mortal_strike Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
5:41.130 hamstring Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, battle_cry
5:42.130 hamstring Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, battle_cry
5:42.215 focused_rage Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, battle_cry
5:42.215 slam Fluffy_Pillow 76.1/130: 59% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
5:43.572 focused_rage Fluffy_Pillow 64.1/130: 49% rage focused_rage(2)
5:43.578 Waiting 1.200 sec 64.1/130: 49% rage focused_rage(2)
5:44.778 focused_rage Fluffy_Pillow 89.3/130: 69% rage focused_rage(2)
5:44.929 colossus_smash Fluffy_Pillow 77.3/130: 59% rage focused_rage(3)
5:46.291 mortal_strike Fluffy_Pillow 77.3/130: 59% rage focused_rage(3), precise_strikes, shattered_defenses
5:46.291 focused_rage Fluffy_Pillow 56.5/130: 43% rage focused_rage
5:47.653 Waiting 2.900 sec 93.0/130: 72% rage focused_rage
5:50.553 slam Fluffy_Pillow 118.2/130: 91% rage focused_rage
5:50.553 focused_rage Fluffy_Pillow 90.2/130: 69% rage focused_rage(2)
5:51.910 focused_rage Fluffy_Pillow 78.2/130: 60% rage focused_rage(3)
5:51.916 mortal_strike Fluffy_Pillow 78.2/130: 60% rage focused_rage(3)
5:53.267 focused_rage Fluffy_Pillow 50.2/130: 39% rage focused_rage
5:53.279 Waiting 3.800 sec 50.2/130: 39% rage focused_rage
5:57.079 slam Fluffy_Pillow 113.0/130: 87% rage focused_rage
5:58.439 colossus_smash Fluffy_Pillow 97.0/130: 75% rage focused_rage
5:58.439 focused_rage Fluffy_Pillow 85.0/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
5:59.796 focused_rage Fluffy_Pillow 73.0/130: 56% rage focused_rage(3), precise_strikes, shattered_defenses
5:59.800 mortal_strike Fluffy_Pillow 73.0/130: 56% rage focused_rage(3), precise_strikes, shattered_defenses
6:01.000 avatar Fluffy_Pillow 89.4/130: 69% rage avatar
6:01.161 colossus_smash Fluffy_Pillow 89.4/130: 69% rage avatar
6:01.161 focused_rage Fluffy_Pillow 77.4/130: 60% rage avatar, focused_rage, precise_strikes, shattered_defenses
6:02.518 focused_rage Fluffy_Pillow 65.4/130: 50% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
6:02.524 mortal_strike Fluffy_Pillow 65.4/130: 50% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
6:03.886 colossus_smash Fluffy_Pillow 81.8/130: 63% rage avatar
6:03.886 focused_rage Fluffy_Pillow 69.8/130: 54% rage avatar, focused_rage, precise_strikes, shattered_defenses
6:05.243 focused_rage Fluffy_Pillow 57.8/130: 44% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
6:05.246 mortal_strike Fluffy_Pillow 57.8/130: 44% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
6:06.606 colossus_smash Fluffy_Pillow 49.0/130: 38% rage avatar
6:07.968 execute Fluffy_Pillow 74.2/130: 57% rage avatar, precise_strikes, shattered_defenses
6:09.329 execute Fluffy_Pillow 56.6/130: 44% rage avatar
6:10.690 execute Fluffy_Pillow 49.8/130: 38% rage avatar
6:12.050 colossus_smash Fluffy_Pillow 17.8/130: 14% rage avatar
6:13.410 battle_cry Fluffy_Pillow 43.0/130: 33% rage avatar, precise_strikes, shattered_defenses
6:13.410 potion Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
6:13.410 hamstring Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:13.410 focused_rage Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:13.410 execute Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
6:14.410 hamstring Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
6:14.767 focused_rage Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
6:14.773 execute Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
6:15.410 hamstring Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
6:16.124 focused_rage Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, potion_of_the_old_war
6:16.135 mortal_strike Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, potion_of_the_old_war
6:16.410 hamstring Fluffy_Pillow 43.0/130: 33% rage avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
6:17.410 hamstring Fluffy_Pillow 79.2/130: 61% rage avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
6:17.498 focused_rage Fluffy_Pillow 79.2/130: 61% rage avatar, corrupted_blood_of_zakajz, battle_cry, potion_of_the_old_war
6:17.498 execute Fluffy_Pillow 79.2/130: 61% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
6:18.859 heroic_leap Fluffy_Pillow 79.2/130: 61% rage avatar, focused_rage, potion_of_the_old_war
6:19.044 colossus_smash Fluffy_Pillow 79.2/130: 61% rage avatar, focused_rage, potion_of_the_old_war
6:20.407 execute Fluffy_Pillow 104.4/130: 80% rage avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:21.768 execute Fluffy_Pillow 86.8/130: 67% rage focused_rage, potion_of_the_old_war
6:23.130 colossus_smash Fluffy_Pillow 80.0/130: 62% rage focused_rage, potion_of_the_old_war
6:24.492 execute Fluffy_Pillow 80.0/130: 62% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:25.854 execute Fluffy_Pillow 62.4/130: 48% rage focused_rage, potion_of_the_old_war
6:27.214 colossus_smash Fluffy_Pillow 55.6/130: 43% rage focused_rage, potion_of_the_old_war
6:28.575 execute Fluffy_Pillow 55.6/130: 43% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:29.937 colossus_smash Fluffy_Pillow 63.2/130: 49% rage focused_rage, potion_of_the_old_war
6:31.300 execute Fluffy_Pillow 63.2/130: 49% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:32.661 colossus_smash Fluffy_Pillow 45.6/130: 35% rage focused_rage, potion_of_the_old_war
6:34.024 execute Fluffy_Pillow 70.8/130: 54% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:35.386 execute Fluffy_Pillow 53.2/130: 41% rage focused_rage, potion_of_the_old_war
6:36.749 colossus_smash Fluffy_Pillow 46.4/130: 36% rage focused_rage, potion_of_the_old_war
6:38.111 execute Fluffy_Pillow 46.4/130: 36% rage focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
6:39.471 execute Fluffy_Pillow 54.0/130: 42% rage focused_rage
6:40.832 warbreaker Fluffy_Pillow 22.0/130: 17% rage focused_rage
6:42.194 execute Fluffy_Pillow 22.0/130: 17% rage focused_rage, precise_strikes, shattered_defenses
6:43.555 colossus_smash Fluffy_Pillow 29.6/130: 23% rage focused_rage
6:44.916 execute Fluffy_Pillow 29.6/130: 23% rage focused_rage, precise_strikes, shattered_defenses
6:46.277 execute Fluffy_Pillow 37.2/130: 29% rage focused_rage
6:47.637 colossus_smash Fluffy_Pillow 5.2/130: 4% rage
6:48.998 battle_cry Fluffy_Pillow 5.2/130: 4% rage precise_strikes, shattered_defenses
6:48.998 hamstring Fluffy_Pillow 5.2/130: 4% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
6:48.998 focused_rage Fluffy_Pillow 5.2/130: 4% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
6:48.998 execute Fluffy_Pillow 5.2/130: 4% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
6:49.998 hamstring Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
6:50.355 focused_rage Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
6:50.359 execute Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
6:50.998 hamstring Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
6:51.712 focused_rage Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
6:51.721 mortal_strike Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
6:51.998 hamstring Fluffy_Pillow 42.2/130: 32% rage corrupted_blood_of_zakajz, battle_cry
6:52.998 hamstring Fluffy_Pillow 78.8/130: 61% rage corrupted_blood_of_zakajz, battle_cry
6:53.083 focused_rage Fluffy_Pillow 78.8/130: 61% rage corrupted_blood_of_zakajz, battle_cry
6:53.083 execute Fluffy_Pillow 78.8/130: 61% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
6:54.445 colossus_smash Fluffy_Pillow 78.8/130: 61% rage focused_rage
6:55.806 execute Fluffy_Pillow 104.0/130: 80% rage focused_rage, precise_strikes, shattered_defenses
6:57.167 execute Fluffy_Pillow 86.4/130: 66% rage focused_rage
6:58.528 execute Fluffy_Pillow 54.4/130: 42% rage focused_rage
6:59.888 colossus_smash Fluffy_Pillow 47.6/130: 37% rage focused_rage
7:01.248 execute Fluffy_Pillow 47.6/130: 37% rage focused_rage, precise_strikes, shattered_defenses
7:02.610 execute Fluffy_Pillow 55.2/130: 42% rage focused_rage
7:03.971 heroic_leap Fluffy_Pillow 23.2/130: 18% rage focused_rage
7:04.044 colossus_smash Fluffy_Pillow 23.2/130: 18% rage focused_rage
7:05.405 execute Fluffy_Pillow 23.2/130: 18% rage focused_rage, precise_strikes, shattered_defenses
7:06.766 execute Fluffy_Pillow 30.8/130: 24% rage focused_rage
7:08.126 bladestorm Fluffy_Pillow 0.0/130: 0% rage focused_rage
7:10.202 execute Fluffy_Pillow 25.2/130: 19% rage focused_rage
7:11.564 Waiting 0.400 sec 0.0/130: 0% rage focused_rage
7:11.964 execute Fluffy_Pillow 25.2/130: 19% rage focused_rage
7:13.326 colossus_smash Fluffy_Pillow 0.0/130: 0% rage focused_rage
7:14.687 Waiting 0.600 sec 0.0/130: 0% rage focused_rage, precise_strikes, shattered_defenses
7:15.287 execute Fluffy_Pillow 25.2/130: 19% rage focused_rage, precise_strikes, shattered_defenses
7:16.648 Waiting 1.900 sec 7.6/130: 6% rage focused_rage
7:18.548 execute Fluffy_Pillow 32.8/130: 25% rage focused_rage
7:19.909 Waiting 0.900 sec 0.8/130: 1% rage focused_rage
7:20.809 battle_cry Fluffy_Pillow 0.8/130: 1% rage focused_rage
7:21.038 hamstring Fluffy_Pillow 0.8/130: 1% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:21.038 focused_rage Fluffy_Pillow 0.8/130: 1% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:21.038 execute Fluffy_Pillow 0.8/130: 1% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
7:22.038 hamstring Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
7:22.395 focused_rage Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
7:22.399 colossus_smash Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
7:23.038 hamstring Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
7:23.761 mortal_strike Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
7:23.761 focused_rage Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:24.038 hamstring Fluffy_Pillow 38.2/130: 29% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:25.038 hamstring Fluffy_Pillow 75.1/130: 58% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:25.123 execute Fluffy_Pillow 75.1/130: 58% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
7:25.123 focused_rage Fluffy_Pillow 75.1/130: 58% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
7:26.485 execute Fluffy_Pillow 75.1/130: 58% rage focused_rage(2)
7:27.846 colossus_smash Fluffy_Pillow 43.1/130: 33% rage focused_rage(2)
7:29.208 execute Fluffy_Pillow 68.3/130: 53% rage focused_rage(2), precise_strikes, shattered_defenses
7:30.572 execute Fluffy_Pillow 50.7/130: 39% rage focused_rage(2)
7:31.000 avatar Fluffy_Pillow 18.7/130: 14% rage avatar, focused_rage(2)
7:31.934 colossus_smash Fluffy_Pillow 43.9/130: 34% rage avatar, focused_rage(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25603 23897 12528 (7706)
Agility 6577 6252 0
Stamina 29905 29905 18456
Intellect 5325 5000 0
Spirit 0 0 0
Health 1794300 1794300 0
Rage 130 130 0
Crit 8.45% 8.45% 1206
Haste 10.50% 10.50% 3414
Damage / Heal Versatility 4.98% 4.98% 1994
Attack Power 25603 23897 0
Mastery 85.92% 83.74% 11854
Armor 3993 3993 3993
Run Speed 7 0 287

Gear

Source Slot Average Item Level: 843.00
Local Head Nightsfall Helmet
ilevel: 850, stats: { 555 Armor, +1297 StrInt, +1945 Sta, +885 Haste, +419 Mastery }, gems: { +150 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 825, stats: { +867 Sta, +1195 Mastery, +478 Vers }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Wardbreaker Pauldrons
ilevel: 850, stats: { 512 Armor, +973 StrInt, +1459 Sta, +637 Vers, +342 Mastery }
Local Chest Ley-Scarred Chestplate
ilevel: 835, stats: { 660 Armor, +1128 StrInt, +1692 Sta, +776 Mastery, +459 Crit }
Local Waist Arcane Defender's Belt
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +574 Mastery, +406 Haste }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Nightsfall Sabatons
ilevel: 835, stats: { 454 Armor, +846 StrInt, +1269 Sta, +562 Haste, +363 Mastery }
Local Wrists Arcane Defender's Wristguards
ilevel: 825, stats: { 283 Armor, +578 StrInt, +867 Sta, +478 Mastery, +191 Haste, +287 RunSpeed }
Local Hands Vindictive Combatant's Plate Gauntlets of the Harmonious
ilevel: 855, stats: { 431 Armor, +1019 Str, +1529 Sta, +712 Mastery, +285 Vers }
Local Finger1 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }, enchant: { +150 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +150 Mastery }
Local Trinket1 Nightmare Bark
ilevel: 830, stats: { +1023 Str, +865 Mastery }
Local Trinket2 Nightborne Defender's Badge
ilevel: 830, stats: { +1023 Str, +865 Mastery }
Local Back Drape of the Raven Lord
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +472 Mastery, +262 Haste }, enchant: { +150 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 873, weapon: { 8315 - 12474, 3.6 }, stats: { +1607 Str, +2411 Sta, +723 Crit, +695 Mastery }, relics: { +43 ilevels, +40 ilevels, +40 ilevels }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Zuan"
origin="https://eu.api.battle.net/wow/character/hyjal/Zuan/advanced"
thumbnail="http://eu.battle.net/static-render/eu/hyjal/240/115091952-avatar.jpg"
level=110
race=human
role=attack
position=back
professions=blacksmithing=761/mining=775
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Za!0222200
artifact=36:0:0:0:0:1136:1:1137:1:1139:1:1141:1:1142:1:1143:2:1145:3:1146:3:1148:3:1149:3:1150:3:1356:1
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/hamstring,if=buff.battle_cry_deadly_calm.remains>cooldown.hamstring.remains
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
# The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike.
# In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=buff.shattered_defenses.down
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>=100|buff.focused_rage.stack=3
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains)
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam,if=buff.battle_cry_deadly_calm.up|buff.focused_rage.stack=3|rage.deficit<=30
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/slam,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=nightsfall_helmet,id=139058,bonus_id=3410/1808/1512/3336,gems=150mastery
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1826/1808/1477/3338,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1512/3336
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1502/3336,enchant=150str
chest=leyscarred_chestplate,id=134311,bonus_id=3432/1497/1674
tabard=renowned_guild_tabard,id=69210
wrists=arcane_defenders_wristguards,id=134274,bonus_id=3396/42/1487/1675
hands=vindictive_combatants_plate_gauntlets,id=135899,bonus_id=3428/1711/1517/3337
waist=arcane_defenders_belt,id=134269,bonus_id=3432/1512/3337
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=nightsfall_sabatons,id=139061,bonus_id=3432/1497/1674
finger1=mindrend_band,id=138220,bonus_id=1807/1472,enchant=150mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1492/3337,enchant=150mastery
trinket1=nightmare_bark,id=121287,bonus_id=3397/605/1492/1675
trinket2=nightborne_defenders_badge,id=134278,bonus_id=3397/605/1492/1675
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=141268/137363/137377/0,relic_id=3397:1512:3337/1727:1492:1813/1727:1492:1813/0

# Gear Summary
# gear_ilvl=842.53
# gear_strength=12528
# gear_stamina=18456
# gear_crit_rating=1182
# gear_haste_rating=3347
# gear_mastery_rating=11622
# gear_versatility_rating=1955
# gear_speed_rating=287
# gear_armor=3993

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length: 348 - 558 ( 450.6 )

Performance:

Total Events Processed: 862805494
Max Event Queue: 565
Sim Seconds: 4508866
CPU Seconds: 2921.4594
Physical Seconds: 417.7015
Speed Up: 1543

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Kwetrose Kwetrose augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kwetrose Kwetrose auto_attack_mh 0 6517755 14466 19.77 36532 73078 148.5 148.5 20.2% 0.0% 0.0% 7.5% 3.06sec 9801431 450.57sec
Kwetrose Kwetrose flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kwetrose Kwetrose food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kwetrose Kwetrose potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kwetrose Kwetrose potion_of_the_old_war 188028 2721728 6041 2.31 130761 261389 17.3 17.3 20.2% 0.0% 0.0% 7.4% 5.15sec 4092821 450.57sec
Kwetrose Kwetrose spear_of_light 214203 654278 1452 1.07 67832 135664 8.0 8.0 20.1% 0.0% 0.0% 0.0% 60.00sec 654278 450.57sec
Kwetrose Kwetrose unholy_strength 53365 0 0 0.00 0 0 27.9 0.0 0.0% 0.0% 0.0% 0.0% 16.14sec 0 450.57sec
Decalang Decalang augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Decalang Decalang auto_attack_mh 0 4581473 10168 30.35 19213 38428 227.9 227.9 23.7% 19.0% 0.0% 0.0% 1.99sec 6735199 450.57sec
Decalang Decalang auto_attack_oh 1 2297260 5099 30.35 9634 19265 227.9 227.9 23.6% 19.0% 0.0% 0.0% 1.99sec 3377190 450.57sec
Decalang Decalang crystalline_swords 205165 4705776 10444 8.83 57455 114918 66.3 66.3 23.6% 0.0% 0.0% 0.0% 13.56sec 4705776 450.57sec
Decalang Decalang empower_rune_weapon 47568 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 181.78sec 0 450.57sec
Decalang Decalang flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Decalang Decalang food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Decalang Decalang frost_fever ticks -55095 5911747 13137 19.88 32058 64110 29.1 149.1 23.7% 0.0% 0.0% 0.0% 15.91sec 5911747 450.57sec
Decalang Decalang frost_strike 49143 0 0 0.00 0 0 82.4 0.0 0.0% 0.0% 0.0% 0.0% 5.44sec 0 450.57sec
Decalang Decalang frost_strike_mh 222026 14535993 32261 10.97 142775 285443 82.4 82.4 23.6% 0.0% 0.0% 0.0% 5.44sec 14535993 450.57sec
Decalang Decalang frost_strike_offhand 66196 7269468 16134 10.97 71399 142671 82.4 82.4 23.6% 0.0% 0.0% 0.0% 5.44sec 7269468 450.57sec
Decalang Decalang frostscythe 207230 10229416 22703 4.42 0 307929 33.2 33.2 100.0% 0.0% 0.0% 0.0% 13.56sec 10229416 450.57sec
Decalang Decalang glacial_advance 194913 0 0 0.00 0 0 31.5 0.0 0.0% 0.0% 0.0% 0.0% 14.51sec 0 450.57sec
Decalang Decalang glacial_advance_damage 195975 6905523 15326 4.19 177666 354597 31.5 31.5 23.7% 0.0% 0.0% 0.0% 14.51sec 6905523 450.57sec
Decalang Decalang howling_blast 49184 5189871 11518 3.87 144250 288843 29.1 29.1 23.6% 0.0% 0.0% 0.0% 15.91sec 5189871 450.57sec
Decalang Decalang infested_ground 221803 1382158 3068 10.50 14172 28344 8.0 78.8 23.7% 0.0% 0.0% 0.0% 60.25sec 1382158 450.57sec
Decalang Decalang obliterate 49020 0 0 0.00 0 0 52.4 0.0 0.0% 0.0% 0.0% 0.0% 8.59sec 0 450.57sec
Decalang Decalang obliterate_mh 222024 5143667 11416 6.98 69068 171264 52.4 52.4 28.5% 0.0% 0.0% 0.0% 8.59sec 7561678 450.57sec
Decalang Decalang obliterate_offhand 66198 2577007 5719 6.98 34531 85659 52.4 52.4 28.7% 0.0% 0.0% 0.0% 8.59sec 3788445 450.57sec
Decalang Decalang pillar_of_frost 51271 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 50.72sec 0 450.57sec
Decalang Decalang potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Decalang Decalang potion_of_the_old_war 188028 3448898 7655 3.12 118963 237926 23.4 23.4 23.7% 0.0% 0.0% 0.0% 3.75sec 5070206 450.57sec
Decalang Decalang razorice_oh 50401 2437162 5409 42.52 6172 12344 319.3 319.3 23.7% 0.0% 0.0% 0.0% 1.41sec 2437162 450.57sec
Decalang Decalang remorseless_winter ticks -196770 2899363 6443 18.33 17064 34113 17.4 137.5 23.6% 0.0% 0.0% 0.0% 26.20sec 2899363 450.57sec
Decalang Decalang unholy_strength 53365 0 0 0.00 0 0 29.9 0.0 0.0% 0.0% 0.0% 0.0% 15.13sec 0 450.57sec
Ethila Ethila augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ethila Ethila auto_attack_mh 0 5109981 11341 30.90 20118 40235 232.1 232.1 28.5% 19.0% 0.0% 0.0% 1.95sec 7512156 450.57sec
Ethila Ethila auto_attack_oh 1 2563722 5690 30.90 10087 20175 232.1 232.1 28.5% 19.0% 0.0% 0.0% 1.95sec 3768914 450.57sec
Ethila Ethila crystalline_swords 205165 4947381 10980 8.93 57396 114769 67.1 67.1 28.5% 0.0% 0.0% 0.0% 13.32sec 4947381 450.57sec
Ethila Ethila empower_rune_weapon 47568 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 180.72sec 0 450.57sec
Ethila Ethila flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ethila Ethila food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ethila Ethila frost_fever ticks -55095 6091946 13538 19.87 31813 63636 28.9 149.0 28.5% 0.0% 0.0% 0.0% 15.69sec 6091946 450.57sec
Ethila Ethila hypothermia 228322 2683348 5955 1.98 140440 281076 14.9 14.9 28.5% 0.0% 0.0% 0.0% 28.09sec 2683348 450.57sec
Ethila Ethila frost_strike 49143 0 0 0.00 0 0 82.5 0.0 0.0% 0.0% 0.0% 0.0% 5.43sec 0 450.57sec
Ethila Ethila frost_strike_mh 222026 15145801 33615 10.98 143028 285977 82.5 82.5 28.4% 0.0% 0.0% 0.0% 5.43sec 15145801 450.57sec
Ethila Ethila frost_strike_offhand 66196 10356343 22985 10.98 97741 195482 82.5 82.5 28.5% 0.0% 0.0% 0.0% 5.43sec 10356343 450.57sec
Ethila Ethila frostscythe 207230 9815467 21784 4.65 0 281010 34.9 34.9 100.0% 0.0% 0.0% 0.0% 12.81sec 9815467 450.57sec
Ethila Ethila glacial_advance 194913 0 0 0.00 0 0 32.0 0.0 0.0% 0.0% 0.0% 0.0% 14.24sec 0 450.57sec
Ethila Ethila glacial_advance_damage 195975 7234414 16056 4.26 176149 352531 32.0 32.0 28.4% 0.0% 0.0% 0.0% 14.24sec 7234414 450.57sec
Ethila Ethila howling_blast 49184 4877981 10826 3.85 131357 263172 28.9 28.9 28.5% 0.0% 0.0% 0.0% 15.69sec 4877981 450.57sec
Ethila Ethila obliterate 49020 0 0 0.00 0 0 51.9 0.0 0.0% 0.0% 0.0% 0.0% 8.65sec 0 450.57sec
Ethila Ethila obliterate_mh 222024 5454017 12105 6.91 72277 170598 51.9 51.9 33.3% 0.0% 0.0% 0.0% 8.65sec 8017922 450.57sec
Ethila Ethila obliterate_offhand 66198 3549752 7878 6.91 46983 110888 51.9 51.9 33.5% 0.0% 0.0% 0.0% 8.65sec 5218471 450.57sec
Ethila Ethila pillar_of_frost 51271 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 49.74sec 0 450.57sec
Ethila Ethila potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ethila Ethila potion_of_the_old_war 188028 3492597 7751 3.08 117582 235163 23.1 23.1 28.4% 0.0% 0.0% 0.0% 3.74sec 5134448 450.57sec
Ethila Ethila razorice 50401 2198597 4880 47.57 4787 9574 357.2 357.2 28.6% 0.0% 0.0% 0.0% 1.26sec 2198597 450.57sec
Ethila Ethila remorseless_winter ticks -196770 3599784 8000 18.39 20323 40645 17.4 137.9 28.4% 0.0% 0.0% 0.0% 26.10sec 3599784 450.57sec
Ethila Ethila rend_flesh ticks -221770 2008842 4464 25.46 8191 16375 56.0 191.0 28.5% 0.0% 0.0% 0.0% 8.10sec 2008842 450.57sec
Ethila Ethila sindragosas_fury 190778 2723975 6046 0.27 1063939 2125651 2.0 2.0 28.1% 0.0% 0.0% 0.0% 0.00sec 2723975 450.57sec
Ethila Ethila unholy_strength 53365 0 0 0.00 0 0 30.4 0.0 0.0% 0.0% 0.0% 0.0% 14.83sec 0 450.57sec
Wadzak Wadzak augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Wadzak Wadzak auto_attack_mh 0 5055601 11220 30.56 20651 41312 229.5 229.5 25.6% 19.0% 0.0% 0.0% 1.97sec 7432213 450.57sec
Wadzak Wadzak auto_attack_oh 1 2532214 5620 30.56 10355 20709 229.5 229.5 25.6% 19.0% 0.0% 0.0% 1.97sec 3722594 450.57sec
Wadzak Wadzak crystalline_swords 205165 5881226 13053 10.35 60200 120435 77.7 77.7 25.7% 0.0% 0.0% 0.0% 11.52sec 5881226 450.57sec
Wadzak Wadzak empower_rune_weapon 47568 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 183.37sec 0 450.57sec
Wadzak Wadzak flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Wadzak Wadzak food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Wadzak Wadzak frost_fever ticks -55095 6329242 14065 19.99 33592 67177 44.5 149.9 25.7% 0.0% 0.0% 0.0% 10.31sec 6329242 450.57sec
Wadzak Wadzak frost_strike 49143 0 0 0.00 0 0 112.9 0.0 0.0% 0.0% 0.0% 0.0% 3.98sec 0 450.57sec
Wadzak Wadzak frost_strike_mh 222026 20395472 45266 15.03 143723 287406 112.9 112.9 25.7% 0.0% 0.0% 0.0% 3.98sec 20395472 450.57sec
Wadzak Wadzak frost_strike_offhand 66196 10773052 23910 15.03 75893 151792 112.9 112.9 25.8% 0.0% 0.0% 0.0% 3.98sec 10773052 450.57sec
Wadzak Wadzak frozen_soul 204959 1070823 2377 2.89 39232 78430 21.7 21.7 25.9% 0.0% 0.0% 0.0% 21.14sec 1070823 450.57sec
Wadzak Wadzak howling_blast 49184 9432811 20935 5.92 168460 337200 44.5 44.5 25.8% 0.0% 0.0% 0.0% 10.31sec 9432811 450.57sec
Wadzak Wadzak obliterate 49020 0 0 0.00 0 0 94.5 0.0 0.0% 0.0% 0.0% 0.0% 4.77sec 0 450.57sec
Wadzak Wadzak obliterate_mh 222024 13315441 29552 12.58 74330 183498 94.5 94.5 61.0% 0.0% 0.0% 0.0% 4.77sec 19574960 450.57sec
Wadzak Wadzak obliterate_offhand 66198 6658706 14778 12.58 37171 91745 94.5 94.5 61.0% 0.0% 0.0% 0.0% 4.77sec 9788929 450.57sec
Wadzak Wadzak obliteration 207256 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 90.30sec 0 450.57sec
Wadzak Wadzak pillar_of_frost 51271 0 0 0.00 0 0 9.9 0.0 0.0% 0.0% 0.0% 0.0% 48.58sec 0 450.57sec
Wadzak Wadzak potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Wadzak Wadzak potion_of_the_old_war 188028 3560271 7902 3.12 120803 241607 23.4 23.4 25.8% 0.0% 0.0% 0.0% 3.72sec 5233935 450.57sec
Wadzak Wadzak razorice 50401 2479123 5502 52.37 5015 10029 393.3 393.3 25.7% 0.0% 0.0% 0.0% 1.15sec 2479123 450.57sec
Wadzak Wadzak remorseless_winter ticks -196770 3799918 8444 22.91 17594 35203 21.7 171.8 25.7% 0.0% 0.0% 0.0% 21.21sec 3799918 450.57sec
Wadzak Wadzak unholy_strength 53365 0 0 0.00 0 0 30.1 0.0 0.0% 0.0% 0.0% 0.0% 14.98sec 0 450.57sec
Kaptah Kaptah augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kaptah Kaptah celestial_alignment 194223 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 185.43sec 0 450.57sec
Kaptah Kaptah deadly_grace 188091 3058983 6789 3.09 108919 217903 23.2 23.2 21.0% 0.0% 0.0% 0.0% 10.17sec 3058983 450.57sec
Kaptah Kaptah flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kaptah Kaptah food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kaptah Kaptah full_moon 202771 7061043 15671 1.29 599920 1199840 10.4 9.7 21.3% 0.0% 0.0% 0.0% 44.68sec 7061043 450.57sec
Kaptah Kaptah half_moon 202768 3897567 8650 1.43 299961 599921 10.8 10.7 21.0% 0.0% 0.0% 0.0% 43.37sec 3897567 450.57sec
Kaptah Kaptah lunar_strike 194153 14917456 33108 7.77 195065 390043 58.3 58.3 31.1% 0.0% 0.0% 0.0% 7.58sec 14917456 450.57sec
Kaptah Kaptah moonfire 8921 1128212 2504 2.81 44261 88463 21.1 21.1 21.0% 0.0% 0.0% 0.0% 22.03sec 7808658 450.57sec
Kaptah Kaptah moonfire ticks -8921 6680446 14845 33.06 22249 44504 21.1 247.9 21.1% 0.0% 0.0% 0.0% 22.03sec 7808658 450.57sec
Kaptah Kaptah moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kaptah Kaptah new_moon 202767 2009254 4459 1.47 149981 299962 10.1 11.1 21.1% 0.0% 0.0% 0.0% 44.35sec 2009254 450.57sec
Kaptah Kaptah potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Kaptah Kaptah rancid_maw 215405 4228768 9385 2.48 187638 375065 18.7 18.6 20.9% 0.0% 0.0% 0.0% 23.51sec 4228768 450.57sec
Kaptah Kaptah shooting_stars 202497 794007 1762 6.05 14433 28878 49.5 45.5 21.0% 0.0% 0.0% 0.0% 8.92sec 794007 450.57sec
Kaptah Kaptah solar_wrath 190984 15202294 33740 13.94 119885 239764 105.1 104.7 21.1% 0.0% 0.0% 0.0% 4.22sec 15202294 450.57sec
Kaptah Kaptah starsurge 78674 18799229 41723 7.86 263176 526419 59.1 59.0 21.1% 0.0% 0.0% 0.0% 7.56sec 18799229 450.57sec
Kaptah Kaptah goldrinns_fang 203001 3279676 7279 2.58 139695 279274 19.5 19.4 21.0% 0.0% 0.0% 0.0% 22.61sec 3279676 450.57sec
Kaptah Kaptah stellar_flare 202347 1581344 3510 2.57 67611 135240 19.3 19.3 21.1% 0.0% 0.0% 0.0% 23.75sec 8221322 450.57sec
Kaptah Kaptah stellar_flare ticks -202347 6639978 14756 32.76 22319 44633 19.3 245.7 21.1% 0.0% 0.0% 0.0% 23.75sec 8221322 450.57sec
Kaptah Kaptah sunfire 93402 631283 1401 1.86 37351 74701 13.9 13.9 21.3% 0.0% 0.0% 0.0% 33.39sec 6285367 450.57sec
Kaptah Kaptah sunfire ticks -93402 5654085 12565 32.99 18873 37748 13.9 247.5 21.1% 0.0% 0.0% 0.0% 33.39sec 6285367 450.57sec
Rinotor Rinotor a_murder_of_crows 131894 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.44sec 0 450.57sec
Rinotor Rinotor crow_peck 131900 9171231 20355 16.68 57963 116825 0.0 125.2 25.9% 0.0% 0.0% 0.0% 0.00sec 13482578 450.57sec
Rinotor Rinotor aspect_of_the_wild 193530 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 127.30sec 0 450.57sec
Rinotor Rinotor augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Rinotor Rinotor auto_shot 0 5083814 11283 23.42 22952 46270 175.9 175.9 25.5% 0.0% 0.0% 0.0% 2.57sec 7473689 450.57sec
Rinotor Rinotor bestial_wrath 19574 0 0 0.00 0 0 12.4 0.0 0.0% 0.0% 0.0% 0.0% 37.71sec 0 450.57sec
Rinotor Rinotor cobra_shot 193455 11662656 25884 10.83 112978 227910 81.5 81.3 26.5% 0.0% 0.0% 0.0% 5.51sec 17145209 450.57sec
Rinotor Rinotor deadly_grace 188091 3378832 7499 3.57 98593 200599 26.8 26.8 26.8% 0.0% 0.0% 0.0% 3.43sec 3378832 450.57sec
Rinotor Rinotor dire_beast 120679 0 0 0.00 0 0 47.2 0.0 0.0% 0.0% 0.0% 0.0% 9.61sec 0 450.57sec
Rinotor Rinotor_dire_beast dire_beast_melee 0 7887258 22382 40.82 26194 52388 239.8 239.8 25.6% 0.0% 0.0% 0.0% 1.88sec 11595016 352.40sec
Rinotor Rinotor_dire_beast stomp 201754 8141842 23104 8.04 137526 275052 47.2 47.2 25.4% 0.0% 0.0% 0.0% 9.61sec 11969279 352.40sec
Rinotor Rinotor flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Rinotor Rinotor food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Rinotor Rinotor kill_command 34026 0 0 0.00 0 0 92.1 0.0 0.0% 0.0% 0.0% 0.0% 4.89sec 0 450.57sec
Rinotor Rinotor_cat kill_command 83381 22675020 50325 12.27 176574 358902 92.1 92.1 38.1% 0.0% 0.0% 0.0% 4.89sec 33334427 450.57sec
Rinotor Rinotor_cat jaws_of_thunder 197162 4527228 10048 4.90 123071 0 36.8 36.8 0.0% 0.0% 0.0% 0.0% 12.13sec 4527228 450.57sec
Rinotor Rinotor_hati kill_command 83381 6906240 15328 12.27 59068 119319 92.1 92.1 26.4% 0.0% 0.0% 0.0% 4.89sec 10152828 450.57sec
Rinotor Rinotor_hati jaws_of_thunder 197162 1379651 3062 4.91 37453 0 36.8 36.8 0.0% 0.0% 0.0% 0.0% 12.17sec 1379651 450.57sec
Rinotor Rinotor mark_of_the_hidden_satyr 191259 1693050 3758 3.30 54337 109469 24.7 24.7 25.5% 0.0% 0.0% 0.0% 18.04sec 1693050 450.57sec
Rinotor Rinotor potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Rinotor Rinotor rancid_maw 215405 4712197 10458 2.63 189749 383269 19.8 19.7 25.5% 0.0% 0.0% 0.0% 22.57sec 4712197 450.57sec
Rinotor Rinotor summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Rinotor Rinotor_cat claw 16827 7231804 16050 20.07 34743 71061 150.7 150.7 36.5% 0.0% 0.0% 0.0% 3.00sec 10631437 450.57sec
Rinotor Rinotor_cat melee 0 7148103 15865 38.32 18074 36605 287.8 287.8 36.5% 0.0% 0.0% 0.0% 1.56sec 10508388 450.57sec
Rinotor Rinotor_hati hati_melee 0 7646616 16971 34.95 23137 46644 261.5 262.5 25.5% 0.0% 0.0% 0.0% 1.72sec 11241250 450.57sec
Ptitchu Ptitchu aimed_shot 19434 45961528 102007 19.79 205818 470455 148.7 148.6 39.1% 0.0% 0.0% 0.0% 3.02sec 67567800 450.57sec
Ptitchu Ptitchu augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitchu Ptitchu auto_shot 0 4753433 10550 22.74 20106 43397 170.8 170.8 33.2% 0.0% 0.0% 0.0% 2.64sec 6987996 450.57sec
Ptitchu Ptitchu barrage ticks -120360 12609241 28021 45.11 27351 57337 21.2 338.4 33.1% 0.0% 0.0% 0.0% 21.79sec 18536779 450.57sec
Ptitchu Ptitchu deadly_grace 188091 4193117 9306 4.35 79886 199012 32.7 32.7 40.6% 0.0% 0.0% 0.0% 13.07sec 4193117 450.57sec
Ptitchu Ptitchu flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitchu Ptitchu food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitchu Ptitchu marked_shot 185901 11970124 26567 5.14 224466 482375 38.6 38.6 33.2% 0.0% 0.0% 0.0% 11.58sec 17597216 450.57sec
Ptitchu Ptitchu potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitchu Ptitchu sidewinders 214579 5165098 11463 6.15 81072 174168 46.2 46.2 33.0% 0.0% 0.0% 0.0% 9.73sec 5165098 450.57sec
Ptitchu Ptitchu summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitchu Ptitchu trueshot 193526 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 209.41sec 0 450.57sec
Ptitchu Ptitchu windburst 204147 7484256 16611 2.68 273512 571937 19.1 20.1 33.1% 0.0% 0.0% 0.0% 22.80sec 11002566 450.57sec
Ptitchu Ptitchu_cat claw 16827 3964683 8799 20.07 18382 36765 150.7 150.7 43.1% 0.0% 0.0% 0.0% 3.00sec 5828459 450.57sec
Ptitchu Ptitchu_cat melee 0 3770114 8367 40.80 8594 17189 306.4 306.4 43.2% 0.0% 0.0% 0.0% 1.47sec 5542425 450.57sec
Ptitchu Ptitchu_spawn_of_serpentrix magma_spit 215754 2643065 22053 46.25 21473 42945 92.7 92.4 33.2% 0.0% 0.0% 0.0% 4.26sec 2643065 119.85sec
Lâstykökö Lâstykökö augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Lâstykökö Lâstykökö combustion 190319 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 120.78sec 0 450.57sec
Lâstykökö Lâstykökö counterspell 2139 0 0 0.00 0 0 11.0 0.0 0.0% 0.0% 0.0% 0.0% 42.33sec 0 450.57sec
Lâstykökö Lâstykökö deadly_grace 188091 3447122 7651 2.92 79173 183894 22.0 22.0 74.3% 0.0% 0.0% 0.0% 7.26sec 3447122 450.57sec
Lâstykökö Lâstykökö dragons_breath 31661 5804324 12882 2.79 163904 361692 20.9 20.9 57.2% 0.0% 0.0% 0.0% 21.89sec 5804324 450.57sec
Lâstykökö Lâstykökö fire_blast 108853 5648741 12537 7.28 0 103391 54.6 54.6 100.0% 0.0% 0.0% 0.0% 8.28sec 5648741 450.57sec
Lâstykökö Lâstykökö fireball 133 15058728 33421 18.18 62530 136912 136.7 136.5 64.3% 0.0% 0.0% 0.0% 3.20sec 15058728 450.57sec
Lâstykökö Lâstykökö flame_on 205029 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 58.94sec 0 450.57sec
Lâstykökö Lâstykökö flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Lâstykökö Lâstykökö food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Lâstykökö Lâstykökö ignite ticks -12846 18155098 40345 59.91 40407 0 335.2 449.3 0.0% 0.0% 0.0% 0.0% 1.35sec 18155098 450.57sec
Lâstykökö Lâstykökö meteor 153561 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 57.69sec 0 450.57sec
Lâstykökö Lâstykökö meteor_impact 153564 2757984 6121 1.04 184393 406312 7.8 7.8 76.2% 0.0% 0.0% 0.0% 57.80sec 2757984 450.57sec
Lâstykökö Lâstykökö meteor_burn ticks -155158 695467 1545 0.00 6146 14912 54.2 0.0 76.3% 0.0% 0.0% 0.0% 7.48sec 695467 450.57sec
Lâstykökö Lâstykökö mirror_image 55342 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 120.62sec 0 450.57sec
Lâstykökö Lâstykökö_mirror_image fireball 88082 8904950 54496 86.13 22915 45829 235.3 234.6 65.7% 0.0% 0.0% 0.0% 5.49sec 8904950 163.41sec
Lâstykökö Lâstykökö phoenix_reborn 215773 1057980 2348 4.98 16390 36943 37.4 37.4 57.9% 0.0% 0.0% 0.0% 11.78sec 1057980 450.57sec
Lâstykökö Lâstykökö phoenixs_flames 194466 4642014 10303 2.73 0 226320 20.5 20.5 100.0% 0.0% 0.0% 0.0% 22.20sec 4642014 450.57sec
Lâstykökö Lâstykökö phoenixs_flames_splash 224637 0 0 0.00 0 0 20.5 0.0 0.0% 0.0% 0.0% 0.0% 22.20sec 0 450.57sec
Lâstykökö Lâstykökö potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Lâstykökö Lâstykökö pyroblast 11366 31169127 69177 15.36 141614 334511 114.6 115.4 66.6% 0.0% 0.0% 0.0% 3.92sec 31169127 450.57sec
Lâstykökö Lâstykökö scorch 2948 19793 44 0.06 0 41172 0.5 0.5 100.0% 0.0% 0.0% 0.0% 14.03sec 19793 450.57sec
Lâstykökö Lâstykökö unstable_magic_explosion 157976 1877285 4166 4.53 55198 0 34.0 34.0 0.0% 0.0% 0.0% 0.0% 12.64sec 1877285 450.57sec
Malikoom Malikoom augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Malikoom Malikoom blackout_kick 100784 11675615 25913 11.52 108339 216794 86.5 86.5 24.5% 0.0% 0.0% 0.0% 5.10sec 17164260 450.57sec
Malikoom Malikoom crackling_jade_lightning ticks -117952 11989 27 0.21 5959 11930 0.8 1.6 25.1% 0.0% 0.0% 0.0% 143.37sec 11989 450.57sec
Malikoom Malikoom energizing_elixir 115288 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 61.54sec 0 450.57sec
Malikoom Malikoom fists_of_fury ticks -113656 17639737 39199 14.30 132125 264568 21.5 107.2 24.5% 0.0% 0.0% 0.0% 21.29sec 25932084 450.57sec
Malikoom Malikoom flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Malikoom Malikoom melee_main_hand 0 2982953 6620 22.29 16880 33763 167.4 167.4 24.6% 19.0% 0.0% 0.0% 2.71sec 4385224 450.57sec
Malikoom Malikoom melee_off_hand 1 1481867 3289 22.16 8442 16883 166.4 166.4 24.5% 19.0% 0.0% 0.0% 2.71sec 2178485 450.57sec
Malikoom Malikoom pepper_breath ticks -225622 1712147 3805 13.50 16968 0 20.3 101.3 0.0% 0.0% 0.0% 0.0% 21.73sec 1712147 450.57sec
Malikoom Malikoom potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Malikoom Malikoom potion_of_the_old_war 188028 2436511 5408 2.63 98885 197842 19.8 19.8 24.7% 0.0% 0.0% 0.0% 7.66sec 3581902 450.57sec
Malikoom Malikoom rising_sun_kick 107428 13114182 29106 5.80 241939 484211 43.5 43.5 24.5% 0.0% 0.0% 0.0% 10.31sec 19279090 450.57sec
Malikoom Malikoom storm_earth_and_fire 137639 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 63.58sec 0 450.57sec
Malikoom Malikoom strike_of_the_windlord 205320 5421941 12033 1.52 383038 766826 11.4 11.4 24.4% 0.0% 0.0% 0.0% 41.35sec 7970766 450.57sec
Malikoom Malikoom strike_of_the_windlord_offhand 205414 2719063 6035 1.52 191509 383466 0.0 11.4 24.7% 0.0% 0.0% 0.0% 0.00sec 3997280 450.57sec
Malikoom Malikoom tiger_palm 100780 3460166 7680 15.27 24213 48453 114.7 114.7 24.6% 0.0% 0.0% 0.0% 3.90sec 5086771 450.57sec
Malikoom Malikoom eye_of_the_tiger_damage ticks -196608 2447685 5439 29.65 11005 0 114.7 222.4 0.0% 0.0% 0.0% 0.0% 3.90sec 2447685 450.57sec
Malikoom Malikoom eye_of_the_tiger_heal 196608 0 0 0.00 0 0 114.7 0.0 0.0% 0.0% 0.0% 0.0% 3.90sec 0 450.57sec
Malikoom Malikoom touch_of_death ticks -115080 4481739 9959 0.56 1062068 0 4.3 4.2 0.0% 0.0% 0.0% 0.0% 120.42sec 0 450.57sec
Malikoom Malikoom whirling_dragon_punch ticks -152175 7247487 16106 8.48 91532 183146 21.2 63.6 24.5% 0.0% 0.0% 0.0% 21.37sec 10654492 450.57sec
Malikoom Malikoom_fire_spirit auto_attack_mh 0 420003 4507 26.56 9665 19327 41.3 41.3 24.5% 19.1% 0.0% 0.0% 10.17sec 617444 93.18sec
Malikoom Malikoom_fire_spirit auto_attack_oh 0 210297 2257 26.56 4832 9665 41.3 41.3 24.5% 19.0% 0.0% 0.0% 10.17sec 309156 93.18sec
Malikoom Malikoom_fire_spirit blackout_kick 100784 1023734 10986 9.44 56167 112402 14.7 14.7 24.2% 0.0% 0.0% 0.0% 29.13sec 1504986 93.18sec
Malikoom Malikoom_fire_spirit crackling_jade_lightning ticks -117952 2347 5 0.08 3055 6120 0.2 0.6 24.1% 0.0% 0.0% 0.0% 197.83sec 2347 93.18sec
Malikoom Malikoom_fire_spirit fists_of_fury ticks -113656 2780238 6178 4.11 72430 144885 6.2 30.8 24.5% 0.0% 0.0% 0.0% 76.48sec 4087214 93.18sec
Malikoom Malikoom_fire_spirit rising_sun_kick 107428 1354857 14540 5.44 128735 257454 8.4 8.4 24.6% 0.0% 0.0% 0.0% 53.02sec 1991768 93.18sec
Malikoom Malikoom_fire_spirit strike_of_the_windlord 222029 1430124 15347 3.91 189277 378394 0.0 6.1 24.3% 0.0% 0.0% 0.0% 0.00sec 2102418 93.18sec
Malikoom Malikoom_fire_spirit strike_of_the_windlord_offhand 205414 723393 7763 3.91 95683 191337 0.0 6.1 24.4% 0.0% 0.0% 0.0% 0.00sec 1063456 93.18sec
Malikoom Malikoom_fire_spirit tiger_palm 100780 366531 3933 14.72 12883 25773 22.9 22.9 24.5% 0.0% 0.0% 0.0% 18.60sec 538835 93.18sec
Malikoom Malikoom_fire_spirit whirling_dragon_punch ticks -152175 1143163 2540 2.35 52183 104362 5.9 17.6 24.5% 0.0% 0.0% 0.0% 78.71sec 1680558 93.18sec
Malikoom Malikoom_earth_spirit auto_attack_mh 0 419217 4499 26.56 9666 19329 41.3 41.3 24.3% 19.2% 0.0% 0.0% 10.17sec 616289 93.18sec
Malikoom Malikoom_earth_spirit auto_attack_oh 0 210499 2259 26.56 4832 9666 41.3 41.3 24.6% 19.0% 0.0% 0.0% 10.17sec 309454 93.18sec
Malikoom Malikoom_earth_spirit blackout_kick 100784 1024841 10998 9.44 56175 112350 14.7 14.7 24.4% 0.0% 0.0% 0.0% 29.13sec 1506613 93.18sec
Malikoom Malikoom_earth_spirit crackling_jade_lightning ticks -117952 2356 5 0.08 3056 6114 0.2 0.6 24.6% 0.0% 0.0% 0.0% 197.83sec 2356 93.18sec
Malikoom Malikoom_earth_spirit fists_of_fury ticks -113656 2779221 6176 4.11 72434 144857 6.2 30.8 24.5% 0.0% 0.0% 0.0% 76.48sec 4085718 93.18sec
Malikoom Malikoom_earth_spirit rising_sun_kick 107428 1354995 14541 5.44 128744 257400 8.4 8.4 24.6% 0.0% 0.0% 0.0% 53.02sec 1991971 93.18sec
Malikoom Malikoom_earth_spirit strike_of_the_windlord 222029 1434423 15393 3.91 189280 378380 0.0 6.1 24.7% 0.0% 0.0% 0.0% 0.00sec 2108738 93.18sec
Malikoom Malikoom_earth_spirit strike_of_the_windlord_offhand 205414 724309 7773 3.91 95670 191413 0.0 6.1 24.5% 0.0% 0.0% 0.0% 0.00sec 1064803 93.18sec
Malikoom Malikoom_earth_spirit tiger_palm 100780 366276 3931 14.72 12886 25759 22.9 22.9 24.4% 0.0% 0.0% 0.0% 18.60sec 538461 93.18sec
Malikoom Malikoom_earth_spirit whirling_dragon_punch ticks -152175 1144604 2544 2.35 52183 104362 5.9 17.6 24.7% 0.0% 0.0% 0.0% 78.71sec 1682676 93.18sec
Müjnir Müjnir augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Müjnir Müjnir blackout_kick 100784 12663005 28104 11.66 112840 225534 87.5 87.5 28.2% 0.0% 0.0% 0.0% 5.04sec 18615816 450.57sec
Müjnir Müjnir chi_burst 123986 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 33.00sec 0 450.57sec
Müjnir Müjnir chi_burst_damage 148135 2607023 5786 1.82 149236 297741 13.6 13.6 28.3% 0.0% 0.0% 0.0% 33.00sec 2607023 450.57sec
Müjnir Müjnir chi_burst_heal 130654 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 33.00sec 0 450.57sec
Müjnir Müjnir crackling_jade_lightning ticks -117952 19164 43 0.33 6038 12093 1.2 2.5 28.2% 0.0% 0.0% 0.0% 116.26sec 19164 450.57sec
Müjnir Müjnir energizing_elixir 115288 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 61.09sec 0 450.57sec
Müjnir Müjnir fists_of_fury ticks -113656 16092049 35760 14.15 118186 236417 21.3 106.1 28.3% 0.0% 0.0% 0.0% 21.50sec 23656837 450.57sec
Müjnir Müjnir crosswinds ticks -195651 3741041 8313 22.61 17207 34389 0.0 169.6 28.3% 0.0% 0.0% 0.0% 0.00sec 5499684 450.57sec
Müjnir Müjnir flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Müjnir Müjnir melee_main_hand 0 2962833 6576 21.29 16971 33945 159.9 159.9 28.2% 19.0% 0.0% 0.0% 2.84sec 4355646 450.57sec
Müjnir Müjnir melee_off_hand 1 1471893 3267 21.15 8488 16970 158.9 158.9 28.2% 19.0% 0.0% 0.0% 2.84sec 2163822 450.57sec
Müjnir Müjnir pepper_breath ticks -225622 1702813 3784 13.43 16963 0 20.2 100.7 0.0% 0.0% 0.0% 0.0% 21.94sec 1702813 450.57sec
Müjnir Müjnir potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Müjnir Müjnir potion_of_the_old_war 188028 2748764 6101 3.05 93665 187095 22.9 22.9 28.1% 0.0% 0.0% 0.0% 6.52sec 4040943 450.57sec
Müjnir Müjnir rising_sun_kick 107428 12544492 27841 5.72 227894 455715 42.9 42.9 28.2% 0.0% 0.0% 0.0% 10.46sec 18441591 450.57sec
Müjnir Müjnir storm_earth_and_fire 137639 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 63.28sec 0 450.57sec
Müjnir Müjnir strike_of_the_windlord 205320 5348075 11870 1.50 369473 738601 11.3 11.3 28.2% 0.0% 0.0% 0.0% 41.64sec 7862176 450.57sec
Müjnir Müjnir strike_of_the_windlord_offhand 205414 2676693 5941 1.50 184614 369924 0.0 11.3 28.2% 0.0% 0.0% 0.0% 0.00sec 3934992 450.57sec
Müjnir Müjnir tiger_palm 100780 3879790 8611 14.63 27554 55142 109.9 109.9 28.1% 0.0% 0.0% 0.0% 4.07sec 5703659 450.57sec
Müjnir Müjnir touch_of_death ticks -115080 4839975 10756 0.56 1146446 0 4.3 4.2 0.0% 0.0% 0.0% 0.0% 120.54sec 0 450.57sec
Müjnir Müjnir whirling_dragon_punch ticks -152175 7663711 17030 8.38 95007 190443 21.0 62.8 28.3% 0.0% 0.0% 0.0% 21.62sec 11266382 450.57sec
Müjnir Müjnir_fire_spirit auto_attack_mh 0 396543 4226 26.54 8764 17532 41.5 41.5 28.1% 19.1% 0.0% 0.0% 10.13sec 582956 93.84sec
Müjnir Müjnir_fire_spirit auto_attack_oh 0 198319 2113 26.54 4382 8766 41.5 41.5 28.1% 19.1% 0.0% 0.0% 10.13sec 291548 93.84sec
Müjnir Müjnir_fire_spirit blackout_kick 100784 961682 10248 9.07 52811 105624 14.2 14.2 28.3% 0.0% 0.0% 0.0% 30.05sec 1413763 93.84sec
Müjnir Müjnir_fire_spirit chi_burst 123986 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 147.93sec 0 93.84sec
Müjnir Müjnir_fire_spirit chi_burst_damage 148135 180779 1926 1.31 68890 137495 0.0 2.1 28.1% 0.0% 0.0% 0.0% 0.00sec 180779 93.84sec
Müjnir Müjnir_fire_spirit crackling_jade_lightning ticks -117952 4104 9 0.15 2858 5709 0.3 1.1 28.5% 0.0% 0.0% 0.0% 138.96sec 4104 93.84sec
Müjnir Müjnir_fire_spirit fists_of_fury ticks -113656 2317962 5151 4.08 59169 118331 6.2 30.6 28.1% 0.0% 0.0% 0.0% 76.65sec 3407624 93.84sec
Müjnir Müjnir_fire_spirit rising_sun_kick 107428 1219078 12991 5.48 110798 221559 8.6 8.6 28.3% 0.0% 0.0% 0.0% 52.47sec 1792160 93.84sec
Müjnir Müjnir_fire_spirit strike_of_the_windlord 222029 1395296 14869 3.88 178564 357172 0.0 6.1 28.6% 0.0% 0.0% 0.0% 0.00sec 2051218 93.84sec
Müjnir Müjnir_fire_spirit strike_of_the_windlord_offhand 205414 704200 7504 3.88 90223 180568 0.0 6.1 28.5% 0.0% 0.0% 0.0% 0.00sec 1035240 93.84sec
Müjnir Müjnir_fire_spirit tiger_palm 100780 375329 4000 14.02 13362 26731 21.9 21.9 28.1% 0.0% 0.0% 0.0% 19.50sec 551769 93.84sec
Müjnir Müjnir_fire_spirit whirling_dragon_punch ticks -152175 1045787 2324 2.21 49303 98618 5.7 16.5 28.2% 0.0% 0.0% 0.0% 82.22sec 1537406 93.84sec
Müjnir Müjnir_earth_spirit auto_attack_mh 0 396738 4228 26.54 8765 17530 41.5 41.5 28.1% 19.1% 0.0% 0.0% 10.13sec 583242 93.84sec
Müjnir Müjnir_earth_spirit auto_attack_oh 0 198459 2115 26.54 4383 8766 41.5 41.5 28.2% 19.1% 0.0% 0.0% 10.13sec 291754 93.84sec
Müjnir Müjnir_earth_spirit blackout_kick 100784 960800 10239 9.07 52815 105605 14.2 14.2 28.2% 0.0% 0.0% 0.0% 30.05sec 1412466 93.84sec
Müjnir Müjnir_earth_spirit chi_burst 123986 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 147.93sec 0 93.84sec
Müjnir Müjnir_earth_spirit chi_burst_damage 148135 180879 1928 1.31 68845 137726 0.0 2.1 28.1% 0.0% 0.0% 0.0% 0.00sec 180879 93.84sec
Müjnir Müjnir_earth_spirit crackling_jade_lightning ticks -117952 4097 9 0.15 2858 5708 0.3 1.1 28.3% 0.0% 0.0% 0.0% 138.96sec 4097 93.84sec
Müjnir Müjnir_earth_spirit fists_of_fury ticks -113656 2318377 5152 4.08 59168 118333 6.2 30.6 28.2% 0.0% 0.0% 0.0% 76.65sec 3408234 93.84sec
Müjnir Müjnir_earth_spirit rising_sun_kick 107428 1218323 12983 5.48 110783 221637 8.6 8.6 28.2% 0.0% 0.0% 0.0% 52.47sec 1791051 93.84sec
Müjnir Müjnir_earth_spirit strike_of_the_windlord 222029 1390564 14819 3.88 178576 357110 0.0 6.1 28.2% 0.0% 0.0% 0.0% 0.00sec 2044261 93.84sec
Müjnir Müjnir_earth_spirit strike_of_the_windlord_offhand 205414 704015 7502 3.88 90240 180481 0.0 6.1 28.4% 0.0% 0.0% 0.0% 0.00sec 1034969 93.84sec
Müjnir Müjnir_earth_spirit tiger_palm 100780 375647 4003 14.02 13363 26728 21.9 21.9 28.2% 0.0% 0.0% 0.0% 19.50sec 552237 93.84sec
Müjnir Müjnir_earth_spirit whirling_dragon_punch ticks -152175 1044491 2321 2.21 49301 98629 5.7 16.5 28.1% 0.0% 0.0% 0.0% 82.22sec 1535500 93.84sec
Squallz Squallz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Squallz Squallz avenging_wrath 31884 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 120.11sec 0 450.57sec
Squallz Squallz blade_of_wrath 202270 5747436 12756 9.08 71110 142270 68.2 68.2 18.5% 0.0% 0.0% 0.0% 6.62sec 10827082 450.57sec
Squallz Squallz blade_of_wrath ticks -202270 5079646 11288 26.79 21335 42671 68.2 200.9 18.5% 0.0% 0.0% 0.0% 6.62sec 10827082 450.57sec
Squallz Squallz blessing_of_might_proc 205729 7653503 16986 23.59 43195 0 206.8 177.2 0.0% 0.0% 0.0% 0.0% 2.65sec 7653503 450.57sec
Squallz Squallz echoed_verdict 224266 3118789 6922 11.26 31110 62203 84.5 84.5 18.6% 0.0% 0.0% 0.0% 5.29sec 3118789 450.57sec
Squallz Squallz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Squallz Squallz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Squallz Squallz greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Squallz Squallz judgment 20271 7619771 16911 5.86 146249 292377 44.0 44.0 18.5% 0.0% 0.0% 0.0% 10.29sec 7619771 450.57sec
Squallz Squallz justicars_vengeance 215661 8530387 18932 2.73 350814 702613 20.5 20.5 18.6% 0.0% 0.0% 0.0% 20.71sec 8530387 450.57sec
Squallz Squallz melee 0 5120321 11364 20.08 28647 57303 150.8 150.8 18.5% 0.0% 0.0% 0.0% 2.98sec 7527356 450.57sec
Squallz Squallz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Squallz Squallz potion_of_the_old_war 188028 3902202 8661 2.87 152895 305732 21.5 21.5 18.5% 0.0% 0.0% 0.0% 6.91sec 5736607 450.57sec
Squallz Squallz rebuke 96231 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 32.08sec 0 450.57sec
Squallz Squallz shield_of_vengeance 184662 0 0 0.74 0 0 5.5 5.5 18.6% 0.0% 0.0% 0.0% 90.00sec 3426113 450.57sec
Squallz Squallz shield_of_vengeance_proc 184689 4391287 9746 0.71 695906 1401040 5.5 5.3 18.4% 0.0% 0.0% 0.0% 89.66sec 4391287 450.57sec
Squallz Squallz templars_verdict 85256 31187717 69218 11.26 311082 622188 84.6 84.6 18.5% 0.0% 0.0% 0.0% 5.29sec 31187717 450.57sec
Squallz Squallz wake_of_ashes 205273 3139468 6968 1.92 184153 368147 14.4 14.4 18.5% 0.0% 0.0% 0.0% 32.47sec 3139468 450.57sec
Squallz Squallz zeal 217020 16069104 35664 15.77 99378 198766 118.4 118.4 36.5% 0.0% 0.0% 0.0% 3.81sec 23623106 450.57sec
Waleràn Waleràn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Waleràn Waleràn deadly_grace 188091 3052762 6775 3.89 86889 177265 29.2 29.2 19.5% 0.0% 0.0% 0.0% 15.96sec 3052762 450.57sec
Waleràn Waleràn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Waleràn Waleràn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Waleràn Waleràn mind_blast 8092 9855044 21872 8.30 131541 268396 61.3 62.3 19.4% 0.0% 0.0% 0.0% 7.23sec 9855044 450.57sec
Waleràn Waleràn mind_flay ticks -15407 14076644 31281 58.90 26509 54077 139.6 441.7 19.4% 0.0% 0.0% 0.0% 3.21sec 14076644 450.57sec
Waleràn Waleràn mindbender 200174 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 60.52sec 0 450.57sec
Waleràn Waleràn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Waleràn Waleràn shadow_word_death 32379 3103798 6889 2.11 163204 333045 15.8 15.8 19.5% 0.0% 0.0% 0.0% 10.53sec 3103798 450.57sec
Waleràn Waleràn shadow_word_pain 589 104785 233 0.40 28739 58678 3.0 3.0 19.3% 0.0% 0.0% 0.0% 114.47sec 15906311 450.57sec
Waleràn Waleràn shadow_word_pain ticks -589 15801527 35115 44.35 39514 80575 3.0 332.7 19.5% 0.0% 0.0% 0.0% 114.47sec 15906311 450.57sec
Waleràn Waleràn shadowy_apparitions 78203 2478263 5500 11.94 23000 46920 90.5 89.6 19.4% 0.0% 0.0% 0.0% 4.90sec 2478263 450.57sec
Waleràn Waleràn vampiric_touch ticks -34914 18088230 40196 29.42 68165 139038 1.0 220.6 19.5% 0.0% 0.0% 0.0% 135.21sec 18088230 450.57sec
Waleràn Waleràn void_bolt 205448 14951442 33183 11.44 144707 295143 86.2 85.9 19.5% 0.0% 0.0% 0.0% 5.09sec 14951442 450.57sec
Waleràn Waleràn void_eruption 228360 1553496 3448 3.41 50289 102614 12.9 25.6 19.7% 0.0% 0.0% 0.0% 35.61sec 1553496 450.57sec
Waleràn Waleràn void_torrent ticks -205065 5752752 12784 7.26 87897 179239 7.5 54.5 19.4% 0.0% 0.0% 0.0% 63.18sec 5752752 450.57sec
Waleràn Waleràn_mindbender melee 0 6955771 59367 56.00 53283 106564 109.3 109.3 19.4% 0.0% 0.0% 0.0% 4.02sec 6955771 117.17sec
Waleràn Waleràn_mindbender shadowcrawl 63619 0 0 0.00 0 0 23.5 0.0 0.0% 0.0% 0.0% 0.0% 19.14sec 0 117.17sec
Ptitfille Ptitfille augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitfille Ptitfille auto_attack_mh 0 5800571 12874 37.21 17743 35474 279.4 279.4 36.0% 19.0% 0.0% 0.0% 1.62sec 8527388 450.57sec
Ptitfille Ptitfille auto_attack_oh 1 2880406 6393 36.97 8872 17745 277.6 277.6 36.0% 19.0% 0.0% 0.0% 1.62sec 4234469 450.57sec
Ptitfille Ptitfille deadly_poison_dot ticks -2818 5464963 12144 19.93 26858 53740 501.8 149.5 36.1% 0.0% 0.0% 0.0% 1.03sec 5464963 450.57sec
Ptitfille Ptitfille deadly_poison_instant 113780 11535771 25603 66.69 16925 33854 500.8 500.8 36.1% 0.0% 0.0% 0.0% 1.03sec 11535771 450.57sec
Ptitfille Ptitfille envenom 32645 12153439 26973 4.57 260348 520864 34.3 34.3 35.9% 0.0% 0.0% 0.0% 12.92sec 12153439 450.57sec
Ptitfille Ptitfille exsanguinate 200806 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 46.56sec 0 450.57sec
Ptitfille Ptitfille flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitfille Ptitfille food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitfille Ptitfille garrote ticks -703 12558907 27909 34.67 35492 71015 29.6 260.0 36.1% 0.0% 0.0% 0.0% 15.48sec 12558907 450.57sec
Ptitfille Ptitfille kingsbane ticks -192759 5365617 11924 9.18 57251 114590 10.0 68.9 36.0% 0.0% 0.0% 0.0% 46.55sec 5365617 450.57sec
Ptitfille Ptitfille kingsbane_mh 222062 1345236 2986 1.33 98887 197877 10.0 10.0 35.9% 0.0% 0.0% 0.0% 46.55sec 1345236 450.57sec
Ptitfille Ptitfille kingsbane_oh 192760 672476 1492 1.33 49484 98880 10.0 10.0 35.9% 0.0% 0.0% 0.0% 46.55sec 672476 450.57sec
Ptitfille Ptitfille mutilate 1329 0 0 0.00 0 0 134.8 0.0 0.0% 0.0% 0.0% 0.0% 3.34sec 0 450.57sec
Ptitfille Ptitfille mutilate_mh 5374 13191511 29277 17.95 71916 143845 134.8 134.8 36.1% 0.0% 0.0% 0.0% 3.34sec 19392770 450.57sec
Ptitfille Ptitfille mutilate_oh 27576 6591376 14629 17.95 35964 71890 134.8 134.8 36.0% 0.0% 0.0% 0.0% 3.34sec 9689947 450.57sec
Ptitfille Ptitfille poison_bomb 192660 4643640 10306 5.96 76267 152519 44.8 44.8 35.9% 0.0% 0.0% 0.0% 7.90sec 4643640 450.57sec
Ptitfille Ptitfille potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Ptitfille Ptitfille potion_of_the_old_war 188028 5273846 11705 3.04 170016 340009 22.8 22.8 35.9% 0.0% 0.0% 0.0% 5.57sec 7753053 450.57sec
Ptitfille Ptitfille rupture ticks -1943 40491233 89981 41.47 95608 191437 30.2 311.0 36.1% 0.0% 0.0% 0.0% 15.08sec 40491233 450.57sec
Ptitfille Ptitfille vanish 1856 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 139.65sec 0 450.57sec
Ptitfille Ptitfille vendetta 79140 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 92.59sec 0 450.57sec
Ptitfille Ptitfille wind_bolt 227870 4986668 11067 7.18 67987 135962 53.9 53.9 36.1% 0.0% 0.0% 0.0% 7.18sec 4986668 450.57sec
Oshamëren Oshamëren ascendance 114050 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 450.57sec
Oshamëren Oshamëren augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Oshamëren Oshamëren deadly_grace 188091 2834578 6291 3.81 82182 164363 28.6 28.6 20.4% 0.0% 0.0% 0.0% 7.61sec 2834578 450.57sec
Oshamëren Oshamëren earth_shock 8042 10083769 22380 5.03 204481 511195 37.8 37.8 20.4% 0.0% 0.0% 0.0% 11.81sec 10083769 450.57sec
Oshamëren Oshamëren elemental_mastery 16166 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 450.57sec
Oshamëren Oshamëren fire_elemental 198067 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 223.49sec 0 450.57sec
Oshamëren Oshamëren flame_shock 188389 516538 1146 1.91 27521 68787 14.3 14.3 20.6% 0.0% 0.0% 0.0% 32.37sec 6798426 450.57sec
Oshamëren Oshamëren flame_shock ticks -188389 6281888 13960 42.15 15205 38011 14.3 316.1 20.5% 0.0% 0.0% 0.0% 32.37sec 6798426 450.57sec
Oshamëren Oshamëren flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Oshamëren Oshamëren lava_burst 51505 17412519 38645 11.70 0 198231 88.0 87.8 100.0% 0.0% 0.0% 0.0% 5.11sec 17412519 450.57sec
Oshamëren Oshamëren lava_burst_overload 77451 4014290 8909 3.70 0 144356 27.9 27.8 100.0% 0.0% 0.0% 0.0% 15.87sec 4014290 450.57sec
Oshamëren Oshamëren lightning_bolt 188196 15326323 34015 25.02 62458 155922 187.9 187.9 20.5% 0.0% 0.0% 0.0% 2.38sec 15326323 450.57sec
Oshamëren Oshamëren lightning_bolt_overload 45284 6890005 15292 14.32 48993 122551 107.5 107.5 20.5% 0.0% 0.0% 0.0% 4.64sec 6890005 450.57sec
Oshamëren Oshamëren pepper_breath ticks -225622 1971534 4381 16.06 16987 0 24.1 120.5 0.0% 0.0% 0.0% 0.0% 18.67sec 1971534 450.57sec
Oshamëren Oshamëren potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Oshamëren Oshamëren stormkeeper 205495 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 65.02sec 0 450.57sec
Oshamëren Oshamëren totem_mastery 210643 0 0 0.00 0 0 4.5 0.0 0.0% 0.0% 0.0% 0.0% 111.24sec 0 450.57sec
Oshamëren Oshamëren_primal_fire_elemental fire_blast 57984 10315559 70065 28.06 124331 248662 68.9 68.9 20.5% 0.0% 0.0% 0.0% 5.66sec 10315559 147.23sec
Oshamëren Oshamëren_primal_fire_elemental immolate 118297 329081 2235 3.03 36839 73678 7.4 7.4 20.3% 0.0% 0.0% 0.0% 58.82sec 1598757 147.23sec
Oshamëren Oshamëren_primal_fire_elemental immolate ticks -118297 1269675 2822 10.76 13064 26131 7.4 80.7 20.4% 0.0% 0.0% 0.0% 58.82sec 1598757 147.23sec
Dèmonos Dèmonos augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos chaos_bolt 116858 22350777 49605 6.92 0 430261 51.2 51.9 100.0% 0.0% 0.0% 0.0% 8.66sec 22350777 450.57sec
Dèmonos Dèmonos conflagrate 17962 5809843 12894 6.25 102688 205431 47.0 47.0 20.5% 0.0% 0.0% 0.0% 9.65sec 5809843 450.57sec
Dèmonos Dèmonos deadly_grace 188091 2339427 5192 3.12 82904 165808 23.4 23.4 20.6% 0.0% 0.0% 0.0% 20.01sec 2339427 450.57sec
Dèmonos Dèmonos dimensional_rift 196586 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 22.15sec 0 450.57sec
Dèmonos Dèmonos flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos immolate 348 2188806 4858 3.40 71269 142477 25.5 25.5 20.5% 0.0% 0.0% 0.0% 17.93sec 10809144 450.57sec
Dèmonos Dèmonos immolate ticks -348 8620338 19156 24.79 38488 77005 25.5 185.9 20.5% 0.0% 0.0% 0.0% 17.93sec 10809144 450.57sec
Dèmonos Dèmonos incinerate 29722 24777496 54991 23.13 118367 236692 174.5 173.7 20.5% 0.0% 0.0% 0.0% 2.54sec 24777496 450.57sec
Dèmonos Dèmonos life_tap 1454 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos service_imp 111859 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 91.01sec 0 450.57sec
Dèmonos Dèmonos summon_doomguard 18540 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 183.07sec 0 450.57sec
Dèmonos Dèmonos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Dèmonos Dèmonos_imp firebolt 3110 6369100 14136 18.65 37728 75455 140.8 140.1 20.5% 0.0% 0.0% 0.0% 3.20sec 6369100 450.57sec
Dèmonos Dèmonos_service_imp firebolt 3110 5914504 41741 27.47 75637 151274 65.2 64.9 20.5% 0.0% 0.0% 0.0% 6.56sec 5914504 141.70sec
Dèmonos Dèmonos_doomguard doom_bolt 85692 2063485 29034 24.03 60190 120423 28.6 28.5 20.4% 0.0% 0.0% 0.0% 13.31sec 2063485 71.07sec
Dèmonos Dèmonos_shadowy_tear shadow_bolt ticks -196657 4449250 9887 8.59 57537 114999 7.0 64.4 20.5% 0.0% 0.0% 0.0% 59.94sec 4449250 83.59sec
Dèmonos Dèmonos_chaos_tear chaos_bolt 215279 2580092 77623 12.57 0 370565 7.0 7.0 100.0% 0.0% 0.0% 0.0% 59.64sec 2580092 33.24sec
Dèmonos Dèmonos_chaos_portal chaos_barrage ticks -187394 3913738 8697 26.42 16453 32892 7.1 198.1 20.5% 0.0% 0.0% 0.0% 60.01sec 3913738 33.31sec
Eldiabløød Eldiabløød augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød chaos_bolt 116858 21827258 48444 6.39 0 454877 47.2 48.0 100.0% 0.0% 0.0% 0.0% 9.35sec 21827258 450.57sec
Eldiabløød Eldiabløød conflagrate 17962 5906814 13110 6.00 117149 234629 45.0 45.0 11.9% 0.0% 0.0% 0.0% 10.04sec 5906814 450.57sec
Eldiabløød Eldiabløød deadly_grace 188091 2132643 4733 2.99 84960 169921 22.4 22.4 11.9% 0.0% 0.0% 0.0% 7.05sec 2132643 450.57sec
Eldiabløød Eldiabløød dimensional_rift 196586 0 0 0.00 0 0 19.3 0.0 0.0% 0.0% 0.0% 0.0% 24.70sec 0 450.57sec
Eldiabløød Eldiabløød flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød immolate 348 2730524 6060 3.93 77142 154136 29.5 29.5 19.9% 0.0% 0.0% 0.0% 15.38sec 16504406 450.57sec
Eldiabløød Eldiabløød immolate ticks -348 13773882 30609 23.84 64266 128515 29.5 178.8 19.9% 0.0% 0.0% 0.0% 15.38sec 16504406 450.57sec
Eldiabløød Eldiabløød incinerate 29722 20350910 45167 18.00 134643 269202 135.7 135.2 11.8% 0.0% 0.0% 0.0% 3.22sec 20350910 450.57sec
Eldiabløød Eldiabløød life_tap 1454 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød service_imp 111859 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 94.04sec 0 450.57sec
Eldiabløød Eldiabløød summon_doomguard 18540 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 183.44sec 0 450.57sec
Eldiabløød Eldiabløød summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Eldiabløød Eldiabløød_imp firebolt 3110 5896187 13086 17.98 39049 78124 135.7 135.0 11.8% 0.0% 0.0% 0.0% 3.32sec 5896187 450.57sec
Eldiabløød Eldiabløød_service_imp firebolt 3110 5197822 37811 25.77 78670 157397 59.3 59.1 11.9% 0.0% 0.0% 0.0% 7.14sec 5197822 137.47sec
Eldiabløød Eldiabløød_doomguard doom_bolt 85692 2025604 28628 24.02 63956 127907 28.4 28.3 11.8% 0.0% 0.0% 0.0% 13.41sec 2025604 70.76sec
Eldiabløød Eldiabløød_shadowy_tear shadow_bolt ticks -196657 3805890 8458 7.19 63382 126760 6.4 53.9 11.8% 0.0% 0.0% 0.0% 66.45sec 3805890 77.58sec
Eldiabløød Eldiabløød_chaos_tear chaos_bolt 215279 2266031 74064 12.41 0 358097 6.4 6.3 100.0% 0.0% 0.0% 0.0% 65.39sec 2266031 30.60sec
Eldiabløød Eldiabløød_chaos_portal chaos_barrage ticks -187394 3354086 7454 23.24 17255 34514 6.4 174.3 11.9% 0.0% 0.0% 0.0% 65.98sec 3354086 30.73sec
Zuan Zuan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Zuan Zuan auto_attack_mh 0 9500672 21086 19.07 53524 109467 143.2 143.2 22.9% 0.0% 0.0% 0.0% 3.17sec 13966888 450.57sec
Zuan Zuan avatar 107574 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 90.00sec 0 450.57sec
Zuan Zuan battle_cry 1719 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 33.01sec 0 450.57sec
Zuan Zuan bladestorm 227847 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 96.72sec 0 450.57sec
Zuan Zuan bladestorm_mh 50622 1928360 4280 2.01 117872 236234 0.0 15.1 8.3% 0.0% 0.0% 0.0% 0.00sec 2834872 450.57sec
Zuan Zuan charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Zuan Zuan colossus_smash 167105 17216167 38210 8.22 233980 441870 61.7 61.7 21.7% 0.0% 0.0% 0.0% 7.43sec 25309396 450.57sec
Zuan Zuan corrupted_blood_of_zakajz ticks -209569 13431357 29847 11.13 160907 0 0.0 83.5 0.0% 0.0% 0.0% 0.0% 0.00sec 13431357 450.57sec
Zuan Zuan execute 163201 20163225 44750 5.37 353486 792530 40.3 40.3 33.5% 0.0% 0.0% 0.0% 2.26sec 29641851 450.57sec
Zuan Zuan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Zuan Zuan focused_rage 207982 0 0 0.00 0 0 205.9 0.0 0.0% 0.0% 0.0% 0.0% 2.15sec 0 450.57sec
Zuan Zuan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Zuan Zuan hamstring 1715 360711 801 9.38 0 5121 70.4 70.4 100.0% 0.0% 0.0% 0.0% 6.31sec 530280 450.57sec
Zuan Zuan heroic_leap 6544 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 47.24sec 0 450.57sec
Zuan Zuan mark_of_the_hidden_satyr 191259 2591720 5752 3.22 87245 175774 24.2 24.2 22.5% 0.0% 0.0% 0.0% 18.48sec 2591720 450.57sec
Zuan Zuan mortal_strike 12294 52384256 116262 11.17 385402 916656 83.9 83.9 45.0% 0.0% 0.0% 0.0% 5.25sec 77009819 450.57sec
Zuan Zuan potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.57sec
Zuan Zuan potion_of_the_old_war 188028 7926312 17592 2.91 275801 573023 21.9 21.9 29.1% 0.0% 0.0% 0.0% 19.82sec 11652430 450.57sec
Zuan Zuan slam 1464 10148299 22523 7.31 129553 252461 54.9 54.9 44.9% 0.0% 0.0% 0.0% 6.48sec 14918961 450.57sec
Zuan Zuan warbreaker 209577 1860238 4129 0.95 222288 456401 7.1 7.1 16.8% 0.0% 0.0% 0.0% 66.31sec 1860238 450.57sec

Fluffy_Pillow : 92577 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
92577.4 92577.4 41.7 / 0.045% 8405.9 / 9.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.53% 5.4 100.0% 100%

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Fluffy_Pillow 92577
melee_main_hand_Kwetrose 67622 73.1% 223.8 2.00sec 136171 68086 Direct 223.8 165509 0 136173 0.0% 17.7%  

Stats details: melee_main_hand_Kwetrose

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.78 223.78 0.00 0.00 2.0000 0.0000 30472782.91 48746585.88 37.49 68085.56 68085.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.12 82.27% 165508.88 148957 182059 165508.31 162939 168447 30472783 48746586 37.49
parry 39.67 17.73% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Kwetrose

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Kwetrose 6826 7.4% 15.7 29.15sec 195585 97574 Direct 15.7 195587 0 195587 0.0% 0.0%  

Stats details: melee_nuke_Kwetrose

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.72 15.72 0.00 0.00 2.0045 0.0000 3073967.00 4917351.89 37.49 97573.86 97573.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.72 100.00% 195586.82 176041 215160 195588.78 183992 208994 3073967 4917352 37.49
 
 

Action details: melee_nuke_Kwetrose

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Kwetrose 14534 15.7% 11.4 41.08sec 574794 572244 Periodic 111.2 58895 0 58895 0.0% 0.0% 49.3%

Stats details: spell_dot_Kwetrose

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 0.00 111.15 111.15 1.0045 2.0000 6546471.30 6688518.71 2.12 28006.29 572243.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.2 100.00% 58895.08 58895 58895 58895.08 58895 58895 6546471 6688519 2.12
 
 

Action details: spell_dot_Kwetrose

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Kwetrose 3596 3.9% 12.5 37.10sec 129562 64638 Direct 12.5 129564 0 129564 0.0% 0.0%  

Stats details: spell_nuke_Kwetrose

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.50 12.50 0.00 0.00 2.0045 0.0000 1619896.56 1655045.59 2.12 64638.15 64638.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.50 100.00% 129563.57 116612 142524 129564.85 121726 137416 1619897 1655046 2.12
 
 

Action details: spell_nuke_Kwetrose

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Kwetrose
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.12% 10.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.02% 10.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.85% 10.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.09% 11.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.75% 10.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.90% 10.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.63% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.95% 11.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.52% 9.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.15% 5.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Assassinated 9.4 1.2 46.5sec 40.7sec 22.54% 20.04% 1.2(1.2) 9.1

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:22.54%

Trigger Attempt Success

  • trigger_pct:35.13%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 19.7 49.1 23.1sec 6.6sec 77.60% 79.60% 49.1(49.1) 18.8

Buff details

  • buff initial source:Zuan
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:77.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 26.8 21.2 17.0sec 9.4sec 54.96% 54.96% 21.2(21.2) 26.3

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:54.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 30.5 21.4 14.9sec 8.7sec 59.95% 59.95% 21.4(21.4) 29.9

Buff details

  • buff initial source:Dèmonos
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:59.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 39.5 0.0 11.4sec 11.4sec 54.65% 49.42% 0.0(0.0) 0.4

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:54.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 40.8 3.2 11.1sec 10.3sec 77.33% 72.06% 3.2(3.2) 40.0

Buff details

  • buff initial source:Squallz
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:77.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to $s3 other nearby enemies]?s137027[ and $s2 other nearby enemy][], dealing $s1 Holy damage{$?s76672=false}[, and causing them to take $197277s2% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s137029[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?s137028[, and reducing the remaining cooldown on Shield of the Righteous by $s2 sec, or ${$m2*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane 10.0 177.1 46.6sec 2.3sec 43.46% 84.79% 0.0(0.0) 9.6

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:1.46%
  • kingsbane_2:2.02%
  • kingsbane_3:1.98%
  • kingsbane_4:2.02%
  • kingsbane_5:2.05%
  • kingsbane_6:1.98%
  • kingsbane_7:1.87%
  • kingsbane_8:1.74%
  • kingsbane_9:1.61%
  • kingsbane_10:1.51%
  • kingsbane_11:1.48%
  • kingsbane_12:1.54%
  • kingsbane_13:1.69%
  • kingsbane_14:1.87%
  • kingsbane_15:2.10%
  • kingsbane_16:2.29%
  • kingsbane_17:2.42%
  • kingsbane_18:2.40%
  • kingsbane_19:2.27%
  • kingsbane_20:2.03%
  • kingsbane_21:1.64%
  • kingsbane_22:1.28%
  • kingsbane_23:0.88%
  • kingsbane_24:0.57%
  • kingsbane_25:0.35%
  • kingsbane_26:0.20%
  • kingsbane_27:0.10%
  • kingsbane_28:0.05%
  • kingsbane_29:0.02%
  • kingsbane_30:0.01%
  • kingsbane_31:0.01%
  • kingsbane_32:0.00%
  • kingsbane_33:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%.}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Crane 1.0 285.8 5.4sec 1.6sec 98.78% 98.78% 285.8(285.8) 0.0

Buff details

  • buff initial source:Müjnir
  • cooldown name:buff_mark_of_the_crane
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • mark_of_the_crane_1:98.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228287
  • name:Mark of the Crane
  • tooltip:Increasing the damage of the Monk's Spinning Crane Kick by $s1%.
  • description:{$@spelldesc101546=Spin while kicking in the air, dealing ${4*$107270s1} damage over {$d=1.500 seconds} to enemies within $107270A1 yds.$?c3[ Spinning Crane Kick's damage is increased by $s2% for each unique target you've struck in the last $s3 sec with Tiger Palm, Blackout Kick, or Rising Sun Kick.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Crane 1.0 292.1 5.4sec 1.5sec 98.78% 98.78% 292.1(292.1) 0.0

Buff details

  • buff initial source:Malikoom
  • cooldown name:buff_mark_of_the_crane
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • mark_of_the_crane_1:98.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228287
  • name:Mark of the Crane
  • tooltip:Increasing the damage of the Monk's Spinning Crane Kick by $s1%.
  • description:{$@spelldesc101546=Spin while kicking in the air, dealing ${4*$107270s1} damage over {$d=1.500 seconds} to enemies within $107270A1 yds.$?c3[ Spinning Crane Kick's damage is increased by $s2% for each unique target you've struck in the last $s3 sec with Tiger Palm, Blackout Kick, or Rising Sun Kick.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Razorice 50.3 269.0 9.0sec 1.4sec 85.27% 61.26% 69.6(69.6) 0.0

Buff details

  • buff initial source:Decalang
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:19.04%
  • razorice_2:17.23%
  • razorice_3:15.53%
  • razorice_4:15.02%
  • razorice_5:18.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 54.1 303.1 8.4sec 1.3sec 85.22% 59.81% 88.4(88.4) 0.0

Buff details

  • buff initial source:Ethila
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:17.73%
  • razorice_2:16.92%
  • razorice_3:14.85%
  • razorice_4:14.52%
  • razorice_5:21.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 62.4 330.9 7.3sec 1.1sec 82.99% 63.52% 82.9(82.9) 0.0

Buff details

  • buff initial source:Wadzak
  • cooldown name:buff_razorice
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • razorice_1:16.88%
  • razorice_2:17.16%
  • razorice_3:15.21%
  • razorice_4:16.12%
  • razorice_5:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by $s1%.
  • description:{$@spelldesc53343=Affixes your weapon with a rune that causes $50401s1% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by $51714s1%, stacking up to {$51714u=5} times. Modifying your rune weapon requires a Rune Forge in Ebon Hold.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Roaring Blaze 15.1 29.9 30.8sec 10.0sec 74.16% 65.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:Eldiabløød
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:5.60%
  • roaring_blaze_2:32.36%
  • roaring_blaze_3:34.77%
  • roaring_blaze_4:1.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Vendetta 5.3 0.0 92.6sec 92.6sec 23.24% 21.74% 0.0(0.0) 5.1

Buff details

  • buff initial source:Ptitfille
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:23.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vulnerable (vulnerability) 14.8 90.2 30.9sec 4.3sec 95.34% 92.60% 90.2(90.2) 13.8

Buff details

  • buff initial source:Ptitchu
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:95.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2%.$?a190529[ Aimed Shot critical strike chance increased by $s3%.][] Lasts $6d. Stacks up to {$u=3} times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.67%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3548689.02
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 17087
death count pct 170.75
avg death time 449.71
min death time 347.61
max death time 558.10
dmg taken 1599088293.69

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 450.57
Minimum 347.61
Maximum 558.10
Spread ( max - min ) 210.49
Range [ ( max - min ) / 2 * 100% ] 23.36%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 92577.41
Minimum 84030.12
Maximum 102320.57
Spread ( max - min ) 18290.45
Range [ ( max - min ) / 2 * 100% ] 9.88%
Standard Deviation 2129.0218
5th Percentile 89011.96
95th Percentile 96015.51
( 95th Percentile - 5th Percentile ) 7003.54
Mean Distribution
Standard Deviation 21.2913
95.00% Confidence Intervall ( 92535.68 - 92619.14 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2031
0.1 Scale Factor Error with Delta=300 38694
0.05 Scale Factor Error with Delta=300 154776
0.01 Scale Factor Error with Delta=300 3869402
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 92577.41
Minimum 84030.12
Maximum 102320.57
Spread ( max - min ) 18290.45
Range [ ( max - min ) / 2 * 100% ] 9.88%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 41713117.76
Minimum 30702616.16
Maximum 53578774.08
Spread ( max - min ) 22876157.92
Range [ ( max - min ) / 2 * 100% ] 27.42%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3554203.38
Minimum 3415269.90
Maximum 3711618.88
Spread ( max - min ) 296348.98
Range [ ( max - min ) / 2 * 100% ] 4.17%
Standard Deviation 48583.0470
5th Percentile 3476855.94
95th Percentile 3633226.16
( 95th Percentile - 5th Percentile ) 156370.22
Mean Distribution
Standard Deviation 485.8548
95.00% Confidence Intervall ( 3553251.12 - 3555155.64 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 717
0.1 Scale Factor Error with Delta=300 20148984
0.05 Scale Factor Error with Delta=300 80595938
0.01 Scale Factor Error with Delta=300 2014898472
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1257
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 11.42 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 12.56 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 15.78 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

12344324324342432432434234243423423432443

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_Kwetrose Kwetrose 1605009323.6/1605137633: 100% health vulnerability
0:02.000 spell_dot_Kwetrose Kwetrose 1593837142.7/1605137633: 99% health razorice, razorice(2), colossus_smash, vulnerability, razorice(2)
0:03.005 spell_nuke_Kwetrose Kwetrose 1587350228.3/1605137633: 99% health razorice, razorice(3), colossus_smash, eradication, eradication, vulnerability, razorice(4)
0:05.010 melee_nuke_Kwetrose Kwetrose 1574312321.1/1605137633: 98% health razorice(3), vendetta, colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(2), judgment
0:07.013 Waiting 27.000 sec 1560204827.1/1605137633: 97% health razorice(2), vendetta, colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
0:34.013 melee_nuke_Kwetrose Kwetrose 1408548995.1/1605137633: 88% health Health Decade (80 - 90), razorice(4), razorice(2), colossus_smash, eradication, eradication, hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
0:36.017 Waiting 4.000 sec 1400629989.1/1605137633: 87% health Health Decade (80 - 90), razorice(5), razorice(2), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
0:40.017 spell_nuke_Kwetrose Kwetrose 1384631122.4/1605137633: 86% health Health Decade (80 - 90), razorice(2), razorice(5), roaring_blaze(2), eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
0:42.023 Waiting 1.000 sec 1377460350.3/1605137633: 86% health Health Decade (80 - 90), razorice(4), razorice(5), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
0:43.023 spell_dot_Kwetrose Kwetrose 1371812554.3/1605137633: 85% health Health Decade (80 - 90), razorice(5), razorice(5), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(3), mark_of_the_crane, mark_of_the_crane
0:44.028 Waiting 19.000 sec 1368938806.4/1605137633: 85% health Health Decade (80 - 90), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(4), mark_of_the_crane, mark_of_the_crane
1:03.028 melee_nuke_Kwetrose Kwetrose 1312173132.5/1605137633: 82% health Health Decade (80 - 90), razorice(5), razorice(4), kingsbane(14), eradication, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
1:05.033 Waiting 12.000 sec 1304042794.0/1605137633: 81% health Health Decade (80 - 90), razorice(5), kingsbane(17), eradication, razorice, mark_of_the_crane, mark_of_the_crane
1:17.033 spell_nuke_Kwetrose Kwetrose 1263652559.5/1605137633: 79% health Health Decade (70 - 80), razorice, razorice(5), colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
1:19.037 Waiting 5.000 sec 1254895221.5/1605137633: 78% health Health Decade (70 - 80), razorice(4), colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
1:24.037 spell_dot_Kwetrose Kwetrose 1238952924.7/1605137633: 77% health Health Decade (70 - 80), razorice(5), razorice(4), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), eradication, vulnerability, razorice(3), mark_of_the_crane, mark_of_the_crane
1:25.040 Waiting 7.000 sec 1234462146.4/1605137633: 77% health Health Decade (70 - 80), razorice(5), razorice(4), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), eradication, vulnerability, razorice(4), mark_of_the_crane, mark_of_the_crane
1:32.040 melee_nuke_Kwetrose Kwetrose 1216414991.9/1605137633: 76% health Health Decade (70 - 80), razorice(3), blood_of_the_assassinated, colossus_smash, eradication, eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
1:34.045 Waiting 20.000 sec 1211870448.0/1605137633: 75% health Health Decade (70 - 80), razorice(4), razorice, vendetta, colossus_smash, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
1:54.045 spell_nuke_Kwetrose Kwetrose 1142191390.6/1605137633: 71% health Health Decade (70 - 80), razorice(5), razorice, kingsbane(20), roaring_blaze(3), hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
1:56.050 Waiting 5.000 sec 1136254918.6/1605137633: 71% health Health Decade (70 - 80), razorice(2), kingsbane(20), blood_of_the_assassinated, eradication, roaring_blaze(3), eradication, vulnerability, razorice(4), mark_of_the_crane, mark_of_the_crane
2:01.050 melee_nuke_Kwetrose Kwetrose 1121952049.1/1605137633: 70% health Health Decade (60 - 70), razorice(2), blood_of_the_assassinated, colossus_smash, eradication, eradication, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
2:03.055 Waiting 2.000 sec 1115188723.7/1605137633: 69% health Health Decade (60 - 70), razorice, blood_of_the_assassinated, colossus_smash, eradication, eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
2:05.055 spell_dot_Kwetrose Kwetrose 1104980502.0/1605137633: 69% health Health Decade (60 - 70), razorice(2), razorice(2), colossus_smash, eradication, eradication, hunters_mark, vulnerability, razorice, mark_of_the_crane, mark_of_the_crane
2:06.061 Waiting 24.000 sec 1099621654.6/1605137633: 69% health Health Decade (60 - 70), razorice(2), razorice(4), colossus_smash, eradication, hunters_mark, vulnerability, razorice(2), mark_of_the_crane, mark_of_the_crane
2:30.061 melee_nuke_Kwetrose Kwetrose 1013242252.1/1605137633: 63% health Health Decade (60 - 70), razorice(5), kingsbane(6), colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
2:32.067 spell_nuke_Kwetrose Kwetrose 1007806828.6/1605137633: 63% health Health Decade (60 - 70), razorice, kingsbane(7), colossus_smash, eradication, hunters_mark, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
2:34.071 Waiting 12.000 sec 999727443.4/1605137633: 62% health Health Decade (60 - 70), razorice(2), razorice, kingsbane(8), colossus_smash, eradication, hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
2:46.071 spell_dot_Kwetrose Kwetrose 967206321.8/1605137633: 60% health Health Decade (60 - 70), razorice(4), razorice(2), roaring_blaze(2), razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
2:47.074 Waiting 12.000 sec 964350205.2/1605137633: 60% health Health Decade (60 - 70), razorice(2), eradication, roaring_blaze(2), razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
2:59.074 melee_nuke_Kwetrose Kwetrose 929279371.6/1605137633: 58% health Health Decade (50 - 60), razorice, colossus_smash, eradication, roaring_blaze(3), eradication, vulnerability, razorice(3), mark_of_the_crane, mark_of_the_crane
3:01.080 Waiting 8.000 sec 923014822.1/1605137633: 58% health Health Decade (50 - 60), razorice, razorice, colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
3:09.080 spell_nuke_Kwetrose Kwetrose 895779314.5/1605137633: 56% health Health Decade (50 - 60), razorice(3), razorice(3), vendetta, blood_of_the_assassinated, eradication, hunters_mark, vulnerability, mark_of_the_crane, mark_of_the_crane
3:11.085 Waiting 16.000 sec 888985114.8/1605137633: 55% health Health Decade (50 - 60), razorice(5), razorice(4), vendetta, kingsbane(2), blood_of_the_assassinated, eradication, hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
3:27.085 spell_dot_Kwetrose Kwetrose 828350706.4/1605137633: 52% health Health Decade (50 - 60), razorice(4), razorice, kingsbane(27), colossus_smash, roaring_blaze(3), vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
3:28.090 melee_nuke_Kwetrose Kwetrose 824922149.7/1605137633: 51% health Health Decade (50 - 60), razorice(5), razorice(2), kingsbane(27), colossus_smash, roaring_blaze(3), vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
3:30.092 Waiting 16.000 sec 816698772.7/1605137633: 51% health Health Decade (50 - 60), razorice, razorice(5), kingsbane(27), colossus_smash, eradication, roaring_blaze(3), eradication, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
3:46.092 spell_nuke_Kwetrose Kwetrose 765030418.2/1605137633: 48% health Health Decade (40 - 50), razorice(3), razorice, colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
3:48.095 Waiting 9.000 sec 759206649.8/1605137633: 47% health Health Decade (40 - 50), razorice(4), colossus_smash, roaring_blaze(2), eradication, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
3:57.095 melee_nuke_Kwetrose Kwetrose 731755883.2/1605137633: 46% health Health Decade (40 - 50), razorice, razorice(3), kingsbane(2), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
3:59.101 Waiting 9.000 sec 726975465.4/1605137633: 45% health Health Decade (40 - 50), razorice, razorice(5), kingsbane(8), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
4:08.101 spell_dot_Kwetrose Kwetrose 696446035.3/1605137633: 43% health Health Decade (40 - 50), razorice(2), razorice(4), kingsbane(20), colossus_smash, eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
4:09.105 Waiting 14.000 sec 692791100.0/1605137633: 43% health Health Decade (40 - 50), razorice(2), razorice(4), kingsbane(23), colossus_smash, eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
4:23.105 spell_nuke_Kwetrose Kwetrose 643016688.0/1605137633: 40% health Health Decade (40 - 50), razorice, razorice(5), colossus_smash, eradication, roaring_blaze(2), hunters_mark, vulnerability, razorice(4), mark_of_the_crane, mark_of_the_crane
4:25.110 Waiting 1.000 sec 638289317.7/1605137633: 40% health Health Decade (30 - 40), razorice(2), razorice(5), eradication, roaring_blaze(2), hunters_mark, vulnerability, razorice(5), mark_of_the_crane, mark_of_the_crane
4:26.110 melee_nuke_Kwetrose Kwetrose 635278269.7/1605137633: 40% health Health Decade (30 - 40), razorice(3), razorice, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice(5), mark_of_the_crane, mark_of_the_crane
4:28.114 Waiting 21.000 sec 628824062.9/1605137633: 39% health Health Decade (30 - 40), razorice(5), razorice(2), eradication, roaring_blaze(3), eradication, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
4:49.114 spell_dot_Kwetrose Kwetrose 563473196.2/1605137633: 35% health Health Decade (30 - 40), razorice(2), vendetta, kingsbane(9), colossus_smash, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
4:50.118 Waiting 5.000 sec 560744924.3/1605137633: 35% health Health Decade (30 - 40), razorice(2), razorice, vendetta, kingsbane(11), colossus_smash, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
4:55.118 melee_nuke_Kwetrose Kwetrose 540927238.6/1605137633: 34% health Health Decade (30 - 40), razorice(4), razorice(5), vendetta, kingsbane(19), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, mark_of_the_crane, mark_of_the_crane
4:57.124 Waiting 3.000 sec 533339143.8/1605137633: 33% health Health Decade (30 - 40), razorice(5), kingsbane(20), colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice(2), mark_of_the_crane, mark_of_the_crane
5:00.124 spell_nuke_Kwetrose Kwetrose 524077257.6/1605137633: 33% health Health Decade (30 - 40), razorice, razorice(3), kingsbane(20), colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
5:02.128 Waiting 22.000 sec 519009344.3/1605137633: 32% health Health Decade (30 - 40), razorice(2), razorice(4), colossus_smash, roaring_blaze(3), eradication, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
5:24.128 melee_nuke_Kwetrose Kwetrose 449311179.6/1605137633: 28% health Health Decade (20 - 30), razorice, razorice(4), colossus_smash, roaring_blaze(2), eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
5:26.133 Waiting 4.000 sec 443563105.2/1605137633: 28% health Health Decade (20 - 30), razorice(2), razorice(5), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(2), hunters_mark, vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane
5:30.133 spell_dot_Kwetrose Kwetrose 430828362.1/1605137633: 27% health Health Decade (20 - 30), razorice(5), razorice, kingsbane(5), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
5:31.138 Waiting 6.000 sec 427668354.1/1605137633: 27% health Health Decade (20 - 30), razorice, kingsbane(6), blood_of_the_assassinated, colossus_smash, eradication, roaring_blaze(3), eradication, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
5:37.138 spell_nuke_Kwetrose Kwetrose 409052095.0/1605137633: 25% health Health Decade (20 - 30), razorice(3), kingsbane(13), colossus_smash, eradication, roaring_blaze(3), vulnerability, razorice(4), mark_of_the_crane, mark_of_the_crane
5:39.143 Waiting 14.000 sec 403434592.1/1605137633: 25% health Health Decade (20 - 30), razorice(4), razorice, kingsbane(16), colossus_smash, eradication, roaring_blaze(3), vulnerability, razorice(5), mark_of_the_crane, mark_of_the_crane
5:53.143 melee_nuke_Kwetrose Kwetrose 359352055.3/1605137633: 22% health Health Decade (20 - 30), razorice(2), blood_of_the_assassinated, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
5:55.147 Waiting 16.000 sec 354820508.7/1605137633: 22% health Health Decade (20 - 30), razorice(3), razorice, blood_of_the_assassinated, roaring_blaze(2), eradication, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
6:11.147 spell_dot_Kwetrose Kwetrose 294664761.8/1605137633: 18% health Health Decade (10 - 20), razorice(2), razorice(4), vendetta, colossus_smash, eradication, hunters_mark, vulnerability, razorice(2), mark_of_the_crane, mark_of_the_crane
6:12.150 Waiting 2.000 sec 289770191.2/1605137633: 18% health Health Decade (10 - 20), razorice(2), razorice(5), vendetta, kingsbane(2), colossus_smash, eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
6:14.150 spell_nuke_Kwetrose Kwetrose 279809063.2/1605137633: 17% health Health Decade (10 - 20), razorice(4), vendetta, kingsbane(8), colossus_smash, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
6:16.155 Waiting 6.000 sec 264980784.2/1605137633: 17% health Health Decade (10 - 20), razorice(3), vendetta, kingsbane(10), colossus_smash, hunters_mark, vulnerability, judgment, mark_of_the_crane, mark_of_the_crane
6:22.155 melee_nuke_Kwetrose Kwetrose 239464759.5/1605137633: 15% health Health Decade (10 - 20), razorice, vendetta, kingsbane(16), colossus_smash, roaring_blaze(2), eradication, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
6:24.160 Waiting 27.000 sec 232165171.7/1605137633: 14% health Health Decade (10 - 20), razorice, razorice(4), vendetta, kingsbane(19), colossus_smash, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(3), judgment, mark_of_the_crane, mark_of_the_crane
6:51.160 spell_nuke_Kwetrose Kwetrose 135938282.1/1605137633: 8% health Health Decade (0 - 10), razorice(4), colossus_smash, eradication, vulnerability, razorice, mark_of_the_crane, mark_of_the_crane
6:53.164 spell_dot_Kwetrose Kwetrose 129307830.5/1605137633: 8% health Health Decade (0 - 10), razorice(5), razorice, colossus_smash, roaring_blaze, eradication, hunters_mark, vulnerability, razorice(3), mark_of_the_crane, mark_of_the_crane
6:54.170 melee_nuke_Kwetrose Kwetrose 125919783.4/1605137633: 8% health Health Decade (0 - 10), razorice(5), razorice, colossus_smash, roaring_blaze, hunters_mark, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
6:56.174 Waiting 27.000 sec 119813853.6/1605137633: 7% health Health Decade (0 - 10), razorice(5), razorice(3), colossus_smash, roaring_blaze, hunters_mark, vulnerability, razorice(5), judgment, mark_of_the_crane, mark_of_the_crane
7:23.174 melee_nuke_Kwetrose Kwetrose 31828102.6/1605137633: 2% health Health Decade (0 - 10), razorice(2), colossus_smash, eradication, roaring_blaze, eradication, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
7:25.179 Waiting 3.000 sec 24228844.5/1605137633: 2% health Health Decade (0 - 10), razorice(4), colossus_smash, eradication, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(2), judgment, mark_of_the_crane, mark_of_the_crane
7:28.179 spell_nuke_Kwetrose Kwetrose 14532345.1/1605137633: 1% health Health Decade (0 - 10), razorice(3), razorice(2), colossus_smash, roaring_blaze(2), eradication, hunters_mark, vulnerability, razorice(4), judgment, mark_of_the_crane, mark_of_the_crane
7:30.184 Waiting 3.000 sec 8101930.2/1605137633: 1% health Health Decade (0 - 10), razorice(4), razorice(3), colossus_smash, roaring_blaze(2), vulnerability, razorice, judgment, mark_of_the_crane, mark_of_the_crane

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1918299126 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.